| UniProt ID | BYR1_SCHPO | |
|---|---|---|
| UniProt AC | P10506 | |
| Protein Name | Protein kinase byr1 | |
| Gene Name | byr1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 340 | |
| Subcellular Localization | Cytoplasm . Localizes to the cell tips and septum forming regions. | |
| Protein Description | Serine/threonine protein kinase involved in conjugation and sporulation. It is thought that it is phosphorylated by the byr2 protein kinase and that it can phosphorylate the spk1 kinase. When bound to bob1, is involved in the regulation of sexual differentiation.. | |
| Protein Sequence | MFKRRRNPKGLVLNPNASVKSSDNDHKEELINNQKSFESNVEAFMEQCAHMNRRPAWISDLDNSSLEVVRHLGEGNGGAVSLVKHRNIFMARKTVYVGSDSKLQKQILRELGVLHHCRSPYIVGFYGAFQYKNNISLCMEYMDCGSLDAILREGGPIPLDILGKIINSMVKGLIYLYNVLHIIHRDLKPSNVVVNSRGEIKLCDFGVSGELVNSVAQTFVGTSTYMSPERIRGGKYTVKSDIWSLGISIIELATQELPWSFSNIDDSIGILDLLHCIVQEEPPRLPSSFPEDLRLFVDACLHKDPTLRASPQQLCAMPYFQQALMINVDLASWASNFRSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | NPNASVKSSDNDHKE CCCCCCCCCCCHHHH | 40.54 | 21712547 | |
| 214 | Phosphorylation | VSGELVNSVAQTFVG CCHHHHHHHHHHHCC | 16.02 | - | |
| 218 | Phosphorylation | LVNSVAQTFVGTSTY HHHHHHHHHCCCCCC | 15.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BYR1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BYR1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BYR1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PFD5_SCHPO | bob1 | physical | 11683500 | |
| SPK1_SCHPO | spk1 | physical | 9660817 | |
| BYR2_SCHPO | byr2 | physical | 9315645 | |
| SPK1_SCHPO | spk1 | physical | 23695164 | |
| MOC3_SCHPO | moc3 | physical | 23695164 | |
| CBH1_SCHPO | cbh1 | physical | 23695164 | |
| CBH2_SCHPO | cbh2 | physical | 23695164 | |
| BYR2_SCHPO | byr2 | physical | 23695164 | |
| AFG2_SCHPO | SPBC56F2.07c | physical | 23695164 | |
| WIS1_SCHPO | wis1 | genetic | 8557102 | |
| SPK1_SCHPO | spk1 | physical | 26771498 | |
| YAWC_SCHPO | SPAC3F10.12c | physical | 26771498 | |
| MOC3_SCHPO | moc3 | physical | 26771498 | |
| CBH1_SCHPO | cbh1 | physical | 26771498 | |
| CBH2_SCHPO | cbh2 | physical | 26771498 | |
| BYR2_SCHPO | byr2 | physical | 26771498 | |
| AFG2_SCHPO | SPBC56F2.07c | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
