SPK1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPK1_SCHPO
• UniProt AC: P27638
• Protein Name: Mitogen-activated protein kinase spk1
• Gene Name: spk1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 372
• Subcellular Localization: Nucleus. Mainly nuclear.
• Protein Description: Involved in mating signal transduction pathway..
• Protein Sequence: MASATSTPTIADGNSNKESVATSRSPHTHDLNFELPEEYEMINLIGQGAYGVVCAALHKPSGLKVAVKKIHPFNHPVFCLRTLREIKLLRHFRHENIISILDILPPPSYQELEDVYIVQELMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVADFGLARSTTAQGGNPGFMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSLPFTPKVSFKALFPQASPDAIDLLEKLLTFNPDKRITAEEALKHPYVAAYHDASDEPTASPMPPNLVDLYCNKEDLEIPVLKALIFREVNFR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
199	Phosphorylation	GGNPGFMTEYVATRW CCCCCHHHHHHHHCC	23.15	-
201	Phosphorylation	NPGFMTEYVATRWYR CCCHHHHHHHHCCCC	6.04	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPK1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPK1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPK1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STE11_SCHPO	ste11	physical	15713656
AP1_SCHPO	pap1	genetic	1899230
YEW3_SCHPO	SPAC3G6.03c	physical	26771498
MOC3_SCHPO	moc3	physical	26771498
SIN1_SCHPO	sin1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.