NACB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NACB_SCHPO
• UniProt AC: Q92371
• Protein Name: Nascent polypeptide-associated complex subunit beta
• Gene Name: btf3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 151
• Subcellular Localization: Cytoplasm. Nucleus. Predominantly cytoplasmic, may also transiently localize to the nucleus..
• Protein Description: Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II..
• Protein Sequence: MDPSKLAKLQAGARIGGKGTPRRKVKKPSKSAMSAADDKKVQGALKKLNMQNLAGIQEVNMFKEDGGVINFRAPTVHSSLPNETTAIYGKAEEKTLSEILPGILNNLGPESLTALRQMAEQLKVSEGEKGADAQADDGEIPDLVEKFDEQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	KVKKPSKSAMSAADD CCCCCCHHHCCCCCH	33.28	25720772
34	Phosphorylation	KPSKSAMSAADDKKV CCCHHHCCCCCHHHH	21.74	27738172
75	Phosphorylation	VINFRAPTVHSSLPN EEEEECCCCCCCCCC	29.84	29996109
78	Phosphorylation	FRAPTVHSSLPNETT EECCCCCCCCCCCCC	29.27	29996109
79	Phosphorylation	RAPTVHSSLPNETTA ECCCCCCCCCCCCCC	32.73	29996109
95	Phosphorylation	YGKAEEKTLSEILPG EECCCHHCHHHHCHH	38.50	29996109
97	Phosphorylation	KAEEKTLSEILPGIL CCCHHCHHHHCHHHH	28.02	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NACB_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NACB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NACB_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of NACB_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.