dbPTM

YEEB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YEEB_SCHPO
UniProt AC	O13827
Protein Name	Uncharacterized protein C19A8.11c
Gene Name	SPAC19A8.11c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	246
Subcellular Localization
Protein Description
Protein Sequence	MRVILVIGRSNSGKLDFIKALTGSLPKGLDDEAFNNDHSGLIHKYNIRNKYFEASVGIWIEEYSNLAETLDAYSSEEAKEVIDSLGAIVYTFRSFDEAEWSLFKNFIDKLQLEIPVIGLHMSDEKLLEPPDVFTPEYISISEEGVNEFNEKVGLDRVREILDCCEWNLSQVDKSFSEEKDDAGDFYLPERFKGSPDMQSTDLDNLMKEMNQIRDADLEKNEKKAKALNLLEKLLGDEFEENDYESL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
186	Phosphorylation	KDDAGDFYLPERFKG CCCCCCCCCCHHHCC	26.53	21712547
194	Phosphorylation	LPERFKGSPDMQSTD CCHHHCCCCCCCCCC	20.51	28889911
199	Phosphorylation	KGSPDMQSTDLDNLM CCCCCCCCCCHHHHH	19.76	28889911
200	Phosphorylation	GSPDMQSTDLDNLMK CCCCCCCCCHHHHHH	24.56	25720772
245	Phosphorylation	FEENDYESL------ HHHCCCCCC------	32.90	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YEEB_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YEEB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YEEB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YEEB_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YEEB_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-194, AND MASSSPECTROMETRY.	18257517 [Abstract]