UniProt ID | ROK1_SCHPO | |
---|---|---|
UniProt AC | Q09775 | |
Protein Name | ATP-dependent RNA helicase rok1 | |
Gene Name | rok1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 481 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA.. | |
Protein Sequence | MDALKLLTTNVKFKNKVPQPSIKEKEAKKLQGITKGKAKVTGNNPVDPIEEFPEGILCENLKKQNITECTTIQRYAIPTIGSKRDLLACAPTGSGKTIAYLFPILQKLQLHVPGGYRAIIVAPTRELCEQIYRQAEKLSFGTSLKIIELSKSNEKIQEKAPKLREKYDMCIGTPMRLVQAIQTGLSFEKVEFFVMDEADRLFEPGFIEQTDHILSACTSSNICKSLFSATIPSRVEELAKVVTVDPIRIIVGLKDAATDSIDQRLLFVGSDTSKIVILRQMISNGELKPRVVIFVQDIERAKALYTELLFDEIHVGVIHGELPQAKREEALAKFRKGEIWVLIATDLLARGIDFHGVKMVINFDFPQSVHSYIHRIGRTGRAGNTGQAVTFFTKEDGEYIKLIAGVMRSSGCEVPNWVMALPKPSKEMKKKLKKSPPKRKRITTRASYDRQKEQRKKEYIKKVKKEASIKKHNEATGDSGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ROK1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROK1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROK1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROK1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...