UniProt ID | SWD3_SCHPO | |
---|---|---|
UniProt AC | O43017 | |
Protein Name | Set1 complex component swd3 | |
Gene Name | swd3 {ECO:0000312|EMBL:CAA17803.1} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 380 | |
Subcellular Localization | Nucleus . | |
Protein Description | The Set1 complex specifically methylates 'Lys-4' of histone H3.. | |
Protein Sequence | MDSTAQQFPLNHDLQVQKDQKGVVEEDEEQIHKRIRNYESHSGFSEYCTLFGHEKSVTCVSVSPNKRWIATSSSDGTIKIWSALTFRLECTLFGHYRGISQVKWATGSKYLASASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQDGTCLRMLPAHSEPIISVSISADGTLCATASYDGMARIWDVLSGQCLKTLVEPINVPLSNLQFTENRKYLLVSNLNSQIRLWDYRRNRVVRIFDSHVNTRYSMSWDCYSSKNIPKNTEALPNNDSSYPDDAESFMHDAYLLIPSEDGTIQITDPSTKIIIDDSIRHSDDPETSLLNVTSLGPFIITSGTDPYVRVWAPSLLLSKHEKDGFSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
379 | Phosphorylation | KHEKDGFSP------ CCCCCCCCC------ | 34.92 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWD3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWD3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWD3_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...