YOFE_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOFE_SCHPO
• UniProt AC: Q9P7D5
• Protein Name: Uncharacterized protein P4H10.14c
• Gene Name: SPBP4H10.14c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 308
• Subcellular Localization: Cytoplasm . Localizes at the cell tip and the barrier septum.
• Protein Sequence: MFSGKVRAFIDEELFHSNRNNSSDGLSLDTPLAIHTPAKGFDADLSPQSLYDLHTVTTPVTPLAPDEWDFSLDQSSGVIPSPSSFLSDHNNNNLFSDDTISRQYSNTDDINPSDFGGQCAILDSQNFTLSNASTKSKWSFTKHGSNTPSDSSSPLCNSSKRVVGMLRRFLPSSRMVRLSKAHQPLRIPTTGVSLDSADLTPLSVSTSHLNHPSTSNSPDPLYSASQPPSIKTDASPVDIKNMDAAEKLKKIDLLLEEILQLDSAYDAAERRMIESGWSSVDEIRDVHNKRLDAWSEWKQKLLPLKKCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	IDEELFHSNRNNSSD CCHHHHCCCCCCCCC	30.10	21712547
22	Phosphorylation	FHSNRNNSSDGLSLD HCCCCCCCCCCCCCC	33.10	25720772
23	Phosphorylation	HSNRNNSSDGLSLDT CCCCCCCCCCCCCCC	37.51	29996109
27	Phosphorylation	NNSSDGLSLDTPLAI CCCCCCCCCCCCEEE	29.72	25720772
30	Phosphorylation	SDGLSLDTPLAIHTP CCCCCCCCCEEEECC	26.04	21712547
36	Phosphorylation	DTPLAIHTPAKGFDA CCCEEEECCCCCCCC	20.87	21712547
136	Phosphorylation	LSNASTKSKWSFTKH ECCCCCCCCCEEEEC	39.17	24763107
139	Phosphorylation	ASTKSKWSFTKHGSN CCCCCCCEEEECCCC	27.12	24763107
147	Phosphorylation	FTKHGSNTPSDSSSP EEECCCCCCCCCCCC	26.35	27738172
149	Phosphorylation	KHGSNTPSDSSSPLC ECCCCCCCCCCCCCC	48.35	29996109
235	Phosphorylation	PSIKTDASPVDIKNM CCCCCCCCCCCCCCC	28.41	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOFE_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOFE_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOFE_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YOFE_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.