UniProt ID | YOFE_SCHPO | |
---|---|---|
UniProt AC | Q9P7D5 | |
Protein Name | Uncharacterized protein P4H10.14c | |
Gene Name | SPBP4H10.14c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 308 | |
Subcellular Localization | Cytoplasm . Localizes at the cell tip and the barrier septum. | |
Protein Description | ||
Protein Sequence | MFSGKVRAFIDEELFHSNRNNSSDGLSLDTPLAIHTPAKGFDADLSPQSLYDLHTVTTPVTPLAPDEWDFSLDQSSGVIPSPSSFLSDHNNNNLFSDDTISRQYSNTDDINPSDFGGQCAILDSQNFTLSNASTKSKWSFTKHGSNTPSDSSSPLCNSSKRVVGMLRRFLPSSRMVRLSKAHQPLRIPTTGVSLDSADLTPLSVSTSHLNHPSTSNSPDPLYSASQPPSIKTDASPVDIKNMDAAEKLKKIDLLLEEILQLDSAYDAAERRMIESGWSSVDEIRDVHNKRLDAWSEWKQKLLPLKKCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | IDEELFHSNRNNSSD CCHHHHCCCCCCCCC | 30.10 | 21712547 | |
22 | Phosphorylation | FHSNRNNSSDGLSLD HCCCCCCCCCCCCCC | 33.10 | 25720772 | |
23 | Phosphorylation | HSNRNNSSDGLSLDT CCCCCCCCCCCCCCC | 37.51 | 29996109 | |
27 | Phosphorylation | NNSSDGLSLDTPLAI CCCCCCCCCCCCEEE | 29.72 | 25720772 | |
30 | Phosphorylation | SDGLSLDTPLAIHTP CCCCCCCCCEEEECC | 26.04 | 21712547 | |
36 | Phosphorylation | DTPLAIHTPAKGFDA CCCEEEECCCCCCCC | 20.87 | 21712547 | |
136 | Phosphorylation | LSNASTKSKWSFTKH ECCCCCCCCCEEEEC | 39.17 | 24763107 | |
139 | Phosphorylation | ASTKSKWSFTKHGSN CCCCCCCEEEECCCC | 27.12 | 24763107 | |
147 | Phosphorylation | FTKHGSNTPSDSSSP EEECCCCCCCCCCCC | 26.35 | 27738172 | |
149 | Phosphorylation | KHGSNTPSDSSSPLC ECCCCCCCCCCCCCC | 48.35 | 29996109 | |
235 | Phosphorylation | PSIKTDASPVDIKNM CCCCCCCCCCCCCCC | 28.41 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOFE_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOFE_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOFE_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YOFE_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...