UniProt ID | ATG16_SCHPO | |
---|---|---|
UniProt AC | O94656 | |
Protein Name | Autophagy protein 16 | |
Gene Name | atg16 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 143 | |
Subcellular Localization |
Cytoplasm . Preautophagosomal structure membrane Peripheral membrane protein . |
|
Protein Description | Stabilizes the atg5-atg12 conjugate and mediates the formation of the 350 kDa complex, which is necessary for autophagy. The atg5-atg12/atg16 complex is required for efficient promotion of atg8-conjugation to phosphatidylethanolamine and atg8 localization to the preautophagosomal structure (PAS). Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Required for meiotic chromosome segregation.. | |
Protein Sequence | MELIKKIQDRDAAEKAYYDVIEPYSELLEFSFHKEFVSEEKVTQRTASSDSLNTIASENNDENVINLEEFRQLKRNCDLYQRNLQKLQLLFKQQSQKNTLLEKQLSLQTELNQEKDKRVKILQDELWALQLEVAALERKSPNA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | EEKVTQRTASSDSLN HHHHHHHCCCCCHHH | 25720772 | ||
48 | Phosphorylation | KVTQRTASSDSLNTI HHHHHCCCCCHHHHH | 21712547 | ||
49 | Phosphorylation | VTQRTASSDSLNTIA HHHHCCCCCHHHHHH | 21712547 | ||
51 | Phosphorylation | QRTASSDSLNTIASE HHCCCCCHHHHHHCC | 21712547 | ||
57 | Phosphorylation | DSLNTIASENNDENV CHHHHHHCCCCCCCC | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG16_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG16_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG16_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATG5_SCHPO | atg5 | physical | 23950735 | |
ATG16_SCHPO | atg16 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...