| UniProt ID | ATG16_SCHPO | |
|---|---|---|
| UniProt AC | O94656 | |
| Protein Name | Autophagy protein 16 | |
| Gene Name | atg16 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 143 | |
| Subcellular Localization |
Cytoplasm . Preautophagosomal structure membrane Peripheral membrane protein . |
|
| Protein Description | Stabilizes the atg5-atg12 conjugate and mediates the formation of the 350 kDa complex, which is necessary for autophagy. The atg5-atg12/atg16 complex is required for efficient promotion of atg8-conjugation to phosphatidylethanolamine and atg8 localization to the preautophagosomal structure (PAS). Involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. Required for meiotic chromosome segregation.. | |
| Protein Sequence | MELIKKIQDRDAAEKAYYDVIEPYSELLEFSFHKEFVSEEKVTQRTASSDSLNTIASENNDENVINLEEFRQLKRNCDLYQRNLQKLQLLFKQQSQKNTLLEKQLSLQTELNQEKDKRVKILQDELWALQLEVAALERKSPNA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | EEKVTQRTASSDSLN HHHHHHHCCCCCHHH | 25720772 | ||
| 48 | Phosphorylation | KVTQRTASSDSLNTI HHHHHCCCCCHHHHH | 21712547 | ||
| 49 | Phosphorylation | VTQRTASSDSLNTIA HHHHCCCCCHHHHHH | 21712547 | ||
| 51 | Phosphorylation | QRTASSDSLNTIASE HHCCCCCHHHHHHCC | 21712547 | ||
| 57 | Phosphorylation | DSLNTIASENNDENV CHHHHHHCCCCCCCC | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG16_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG16_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG16_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATG5_SCHPO | atg5 | physical | 23950735 | |
| ATG16_SCHPO | atg16 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
