MUG73_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUG73_SCHPO
• UniProt AC: O74870
• Protein Name: Meiotically up-regulated gene 73 protein
• Gene Name: mug73
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 306
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Has a role in meiosis..
• Protein Sequence: MNAKLSSSGMVLKELPEVALQKISSNYYWAVFAVFLLCAIVFPLVSIFSLPQKQTYHRFFSILSLVSCLAYFTMACNYGLKNVFSSASFFREVSVRMVYYVRYIQWLINFPLIIVMLHWTVGVSILEIAYVVCYVLFAIVCLLAAALTSSPYKWAYYGFSFVGYFIALAHSVVLHKKYASRLETSARLGFLWSIVYLHVIWFLYYACWILSEGLNVISPIGEAIFYSILDLFEFGFFGAAFSWMLDLVGIENFKSPQSIPLGACSPADDKFSMCPDMEAQNQADDLAVETRIQISNLPSSPTKNNC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
299	Phosphorylation	IQISNLPSSPTKNNC HHHCCCCCCCCCCCC	52.71	29996109
300	Phosphorylation	QISNLPSSPTKNNC- HHCCCCCCCCCCCC-	34.35	29996109
302	Phosphorylation	SNLPSSPTKNNC--- CCCCCCCCCCCC---	48.64	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUG73_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUG73_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUG73_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of MUG73_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.