UniProt ID | CWF17_SCHPO | |
---|---|---|
UniProt AC | O94620 | |
Protein Name | Pre-mRNA-splicing factor cwf17 | |
Gene Name | cwf17 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 340 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome.. | |
Protein Sequence | MDKRKESESATNGHLVKRIRIQDSSLITEGSVLQRTSDLNVPNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNVFGDVKNYGVLNGCKGAITDLQWSRDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGVVNALDVLKVGSELLTSVSDDCTMKVWDSRSKDCIKTIEEKYPLTAVAIAQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKPFASAQRQLQIFEGAIHGQEHNLLGVAWSRNSRFVGAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHPHQDIILSCSSDRTIFLGELN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CWF17_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWF17_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWF17_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWF17_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SWC5_SCHPO | swc5 | genetic | 18818364 | |
RIK1_SCHPO | rik1 | genetic | 22681890 | |
FHL1_SCHPO | fhl1 | genetic | 22681890 | |
PPK14_SCHPO | ppk14 | genetic | 22681890 | |
RAF2_SCHPO | raf2 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
SWD3_SCHPO | swd3 | genetic | 22681890 | |
CLR4_SCHPO | clr4 | genetic | 22681890 | |
YDA4_SCHPO | SPAC1F12.04c | genetic | 22681890 | |
YNS7_SCHPO | SPBC18H10.07 | genetic | 22681890 | |
YM04_SCHPO | SPAC212.04c | genetic | 22681890 | |
YCRA_SCHPO | SPCC285.10c | genetic | 22681890 | |
RAF1_SCHPO | raf1 | genetic | 22681890 | |
SEC14_SCHPO | spo20 | genetic | 22681890 | |
YBPD_SCHPO | SPBC16H5.13 | genetic | 22681890 | |
SDE2_SCHPO | sde2 | genetic | 22681890 | |
YI43_SCHPO | SPBC1348.03 | genetic | 22681890 | |
ULP1_SCHPO | ulp1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...