| UniProt ID | SDE2_SCHPO | |
|---|---|---|
| UniProt AC | O14113 | |
| Protein Name | Telomere maintenance protein SDE2 | |
| Gene Name | sde2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 263 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Plays a role in the regulation of telomeric and centromeric silencing. Contributes to the prevention of abnormal telomere elongation. Required for chromosome segregation to daughter cells in mitosis and meiosis. May participate in the recruitment of the histone deacetylase silencing complex SHREC, which prevents transcription at telomeres.. | |
| Protein Sequence | MECKTVFLNGDFLKNSVNVNLNRLATVETLLRHVLGDSYETVLERAYLTHQSRIVHPDIQLCKLEGKSTSAHLNLTLCTRVLGGKGGFGSQLRAAGGRMSKKRNEQENQDSCRDLDGNRLGTIRQAKELSEYLAKKPAETRAKKEAKKQKLNKVLAADSSSSRFDDHEYLEDLEQSVSNVRDAFQNSLLYRRGSTSASSFSSGSNGATTDEPAEKEARNNNSSINSWSRRMQASESSNEAEGEDSESQTSKSLYEWDDPLYGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 176 | Phosphorylation | YLEDLEQSVSNVRDA HHHHHHHHHHHHHHH | 25720772 | ||
| 187 | Phosphorylation | VRDAFQNSLLYRRGS HHHHHHHCHHHCCCC | 25720772 | ||
| 194 | Phosphorylation | SLLYRRGSTSASSFS CHHHCCCCCCCCCCC | 29996109 | ||
| 195 | Phosphorylation | LLYRRGSTSASSFSS HHHCCCCCCCCCCCC | 25720772 | ||
| 198 | Phosphorylation | RRGSTSASSFSSGSN CCCCCCCCCCCCCCC | 25720772 | ||
| 201 | Phosphorylation | STSASSFSSGSNGAT CCCCCCCCCCCCCCC | 29996109 | ||
| 234 | Phosphorylation | WSRRMQASESSNEAE HHHHHHHHCCCCCCC | 25720772 | ||
| 236 | Phosphorylation | RRMQASESSNEAEGE HHHHHHCCCCCCCCC | 25720772 | ||
| 237 | Phosphorylation | RMQASESSNEAEGED HHHHHCCCCCCCCCC | 25720772 | ||
| 245 | Phosphorylation | NEAEGEDSESQTSKS CCCCCCCCCCHHHHC | 25720772 | ||
| 252 | Phosphorylation | SESQTSKSLYEWDDP CCCHHHHCHHCCCCC | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDE2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDE2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDE2_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
