dbPTM

CWC25_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CWC25_SCHPO
UniProt AC	Q9Y805
Protein Name	Pre-mRNA-splicing factor cwf25
Gene Name	cwf25
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	376
Subcellular Localization	Nucleus.
Protein Description	Involved in mRNA splicing..
Protein Sequence	MGGGDLNMKKSWHPLLMRNQEKVWKDEQAHKEEMKRVEQLRREIEEERQLLELHRLQEAAGGKKRKDRVEWMYAVPNTNGPNRDSSEMEEYLLGRRRLDDLLKDKIEDQNNSLEKTEFIALQNANSLQDTQAKLRLDPLLAIKQQEQKQLQTLMEKRKYSLDSDRKSKERRHRDRHHRSNQDRSRERSDNEQHSSDKREHSRRSYRNDRNNWRERTHNDRYRHRDKYDSGYFKKHYDDDMRFDQGHFQDERDLKKYVRTSRQYSRSPSPDFRTRNHQFHSRDSQPITQRHTDIESRLQKMQDNAKELDESRRKKIELLEKKERDEEQFLEKERRDTARKWDNQGDFIRNMRKEIYSGDSVSLADRVNSSRHNMLRP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
112	Phosphorylation	KIEDQNNSLEKTEFI HHHHCCCCCHHHHHH	45.51	21712547
264	Phosphorylation	VRTSRQYSRSPSPDF HHHHHCCCCCCCCCH	20.24	25720772
266	Phosphorylation	TSRQYSRSPSPDFRT HHHCCCCCCCCCHHH	24.64	28889911
268	Phosphorylation	RQYSRSPSPDFRTRN HCCCCCCCCCHHHCC	38.05	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CWC25_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CWC25_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CWC25_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YOI5_SCHPO	SPBC1778.05c	genetic	22681890
RICTR_SCHPO	ste20	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CWC25_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-266 AND SER-268, ANDMASS SPECTROMETRY.	18257517 [Abstract]