UniProt ID | CWC25_SCHPO | |
---|---|---|
UniProt AC | Q9Y805 | |
Protein Name | Pre-mRNA-splicing factor cwf25 | |
Gene Name | cwf25 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 376 | |
Subcellular Localization | Nucleus. | |
Protein Description | Involved in mRNA splicing.. | |
Protein Sequence | MGGGDLNMKKSWHPLLMRNQEKVWKDEQAHKEEMKRVEQLRREIEEERQLLELHRLQEAAGGKKRKDRVEWMYAVPNTNGPNRDSSEMEEYLLGRRRLDDLLKDKIEDQNNSLEKTEFIALQNANSLQDTQAKLRLDPLLAIKQQEQKQLQTLMEKRKYSLDSDRKSKERRHRDRHHRSNQDRSRERSDNEQHSSDKREHSRRSYRNDRNNWRERTHNDRYRHRDKYDSGYFKKHYDDDMRFDQGHFQDERDLKKYVRTSRQYSRSPSPDFRTRNHQFHSRDSQPITQRHTDIESRLQKMQDNAKELDESRRKKIELLEKKERDEEQFLEKERRDTARKWDNQGDFIRNMRKEIYSGDSVSLADRVNSSRHNMLRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
112 | Phosphorylation | KIEDQNNSLEKTEFI HHHHCCCCCHHHHHH | 45.51 | 21712547 | |
264 | Phosphorylation | VRTSRQYSRSPSPDF HHHHHCCCCCCCCCH | 20.24 | 25720772 | |
266 | Phosphorylation | TSRQYSRSPSPDFRT HHHCCCCCCCCCHHH | 24.64 | 28889911 | |
268 | Phosphorylation | RQYSRSPSPDFRTRN HCCCCCCCCCHHHCC | 38.05 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC25_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC25_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC25_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YOI5_SCHPO | SPBC1778.05c | genetic | 22681890 | |
RICTR_SCHPO | ste20 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...