UniProt ID | CWF18_SCHPO | |
---|---|---|
UniProt AC | Q9UU80 | |
Protein Name | Pre-mRNA-splicing factor cwf18 | |
Gene Name | cwf18 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 142 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome.. | |
Protein Sequence | MSSLDEVAESRKQRLAELRKIKQLENKTRDSQEVQKNVIEHRNYDPEVQAPKMGFVEPPNMIESVEALSKEIEEKTKRKIEEQSSVPVEELDLVTLRPKKPTWDLERDLKERMRSLETQNQNAIAFYIQQLISERAHSTEKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
84 | Phosphorylation | KRKIEEQSSVPVEEL HHHHHHHCCCCHHHC | 36.26 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWF18_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWF18_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWF18_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YCRE_SCHPO | trs130 | genetic | 22681890 | |
RL30A_SCHPO | rpl3001 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
CWF16_SCHPO | cwf16 | genetic | 22681890 | |
YK99_SCHPO | SPAC20H4.09 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
RM01_SCHPO | SPAC1610.02c | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
SHF1_SCHPO | shf1 | genetic | 22681890 | |
CWF11_SCHPO | cwf11 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...