CWF18_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CWF18_SCHPO
• UniProt AC: Q9UU80
• Protein Name: Pre-mRNA-splicing factor cwf18
• Gene Name: cwf18
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 142
• Subcellular Localization: Nucleus .
• Protein Description: Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome..
• Protein Sequence: MSSLDEVAESRKQRLAELRKIKQLENKTRDSQEVQKNVIEHRNYDPEVQAPKMGFVEPPNMIESVEALSKEIEEKTKRKIEEQSSVPVEELDLVTLRPKKPTWDLERDLKERMRSLETQNQNAIAFYIQQLISERAHSTEKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	KRKIEEQSSVPVEEL HHHHHHHCCCCHHHC	36.26	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CWF18_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CWF18_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CWF18_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YCRE_SCHPO	trs130	genetic	22681890
RL30A_SCHPO	rpl3001	genetic	22681890
CTBL1_SCHPO	SPAC1952.06c	genetic	22681890
CWF16_SCHPO	cwf16	genetic	22681890
YK99_SCHPO	SPAC20H4.09	genetic	22681890
SSN3_SCHPO	srb10	genetic	22681890
RM01_SCHPO	SPAC1610.02c	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
SHF1_SCHPO	shf1	genetic	22681890
CWF11_SCHPO	cwf11	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.