UniProt ID | SHF1_SCHPO | |
---|---|---|
UniProt AC | Q9UUI2 | |
Protein Name | Small histone ubiquitination factor 1 | |
Gene Name | shf1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 165 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . | |
Protein Description | Component of the histone H2B ubiquitin ligase complex (HULC) which plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation.. | |
Protein Sequence | MSSRRNDYHYDGNDHQYRSPLKSNVDQNSFYESSYRSRQSYHQRTKTPRSSYDSPSSSTNSKEHNSPYHYRVPSNNSTRASFGAASTDTNVELPKINLPDSSLSSKLQSCKSACENSSQSLLNVEQQYAQQVHFWEKIRTDIYREGLRSDAAVKSLNDFVNNVSF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Phosphorylation | TNSKEHNSPYHYRVP CCCCCCCCCCEEECC | 28889911 | ||
70 | Phosphorylation | EHNSPYHYRVPSNNS CCCCCCEEECCCCCC | 21712547 | ||
74 | Phosphorylation | PYHYRVPSNNSTRAS CCEEECCCCCCCCCE | 21712547 | ||
81 | Phosphorylation | SNNSTRASFGAASTD CCCCCCCEECCCCCC | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHF1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHF1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC2_SCHPO | rhp6 | physical | 17363370 | |
BRL2_SCHPO | brl2 | physical | 17363370 | |
BRL1_SCHPO | brl1 | physical | 17363370 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...