UniProt ID | UBC2_SCHPO | |
---|---|---|
UniProt AC | P23566 | |
Protein Name | Ubiquitin-conjugating enzyme E2 2 | |
Gene Name | rhp6 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 151 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins. Component of the histone H2B ubiquitin ligase complex (HULC) which plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation (By similarity). Required for obr1 ubiquitination, which regulates mating-type silencing. With cut8, regulates the nuclear accumulation of the proteasome.. | |
Protein Sequence | MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSWES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UBC2_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BRL1_SCHPO | brl1 | physical | 17374714 | |
BRL2_SCHPO | brl2 | physical | 17374714 | |
MSC1_SCHPO | msc1 | physical | 17456468 | |
MSC1_SCHPO | msc1 | genetic | 17456468 | |
SHF1_SCHPO | shf1 | physical | 17363370 | |
BRL2_SCHPO | brl2 | physical | 17363370 | |
BRL1_SCHPO | brl1 | physical | 17363370 | |
SHF1_SCHPO | shf1 | genetic | 17363370 | |
BRL2_SCHPO | brl2 | genetic | 17363370 | |
BRL1_SCHPO | brl1 | genetic | 17363370 | |
H2B1_SCHPO | htb1 | genetic | 17363370 | |
MPIP_SCHPO | cdc25 | genetic | 10224243 | |
CG23_SCHPO | cdc13 | genetic | 10224243 | |
RAD18_SCHPO | rhp18 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...