RL30A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL30A_SCHPO
• UniProt AC: P52808
• Protein Name: 60S ribosomal protein L30-1
• Gene Name: rpl3001
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 109
• Protein Sequence: MASVVTKKSKKSGDTINAKLALTMKSGKYVLGYKSTLKTLRSGKAKLILIAGNCPPLRKSELEYYAMLSKANVHHYAGTNIDLGTACGKLFRVGVLAITDAGDSDILDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASVVTKKSK -----CCCEEECCCC	18.80	29996109
26	Phosphorylation	KLALTMKSGKYVLGY EEEEEECCCCEEEEE	29.69	28889911
29	Phosphorylation	LTMKSGKYVLGYKST EEECCCCEEEEEHHH	12.39	28889911
60	Phosphorylation	NCPPLRKSELEYYAM CCCCCCHHHHHHHHH	40.77	25720772
104	Phosphorylation	AITDAGDSDILDA-- EEECCCCCCCCCC--	26.15	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL30A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL30A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL30A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL30A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.