UniProt ID | CWC21_SCHPO | |
---|---|---|
UniProt AC | O14161 | |
Protein Name | Pre-mRNA-splicing factor cwf21 | |
Gene Name | cwf21 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 293 | |
Subcellular Localization | Cytoplasm. Nucleus . | |
Protein Description | Involved in pre-mRNA splicing. May function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome. May do so by stabilizing the catalytic center or the position of the RNA substrate (By similarity).. | |
Protein Sequence | MSYNGIGLPTPRGSGTNGYVMRNLSHVKKYDKNTNLQSNRNAKALEKRVQDPSISEHECRRQIESKLLLYREQLLEEVSSQHSTDAAASDSNTNFGTENPKPPKAIIKDEQSQSKTKSLDEADVEILVQKYREQLLKELQLQKSTEKGKNFESILQPQKRKETRGFHSKNDDDGRLEERDDLRSSVDDDYYDYPRYSERKSLNSKRHVDNYNENRRRHYDSYSSYDELERRRSSNESYSRRSELPRRDYNRHDERERYSYHRRRERSNSPSYTKNESIPVVDRDSSPEGGEIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
116 | Phosphorylation | DEQSQSKTKSLDEAD CHHHCCCCCCCCHHH | 30.98 | 25720772 | |
118 | Phosphorylation | QSQSKTKSLDEADVE HHCCCCCCCCHHHHH | 46.41 | 28889911 | |
184 | Phosphorylation | EERDDLRSSVDDDYY CCHHHHHHHCCCCCC | 41.85 | 25720772 | |
267 | Phosphorylation | YHRRRERSNSPSYTK HHHHHHHCCCCCCCC | 36.59 | 25720772 | |
269 | Phosphorylation | RRRERSNSPSYTKNE HHHHHCCCCCCCCCC | 19.23 | 25720772 | |
272 | Phosphorylation | ERSNSPSYTKNESIP HHCCCCCCCCCCCCC | 25.72 | 25720772 | |
273 | Phosphorylation | RSNSPSYTKNESIPV HCCCCCCCCCCCCCC | 31.56 | 25720772 | |
277 | Phosphorylation | PSYTKNESIPVVDRD CCCCCCCCCCCCCCC | 41.40 | 21712547 | |
285 | Phosphorylation | IPVVDRDSSPEGGEI CCCCCCCCCCCCCCC | 49.00 | 28889911 | |
286 | Phosphorylation | PVVDRDSSPEGGEIV CCCCCCCCCCCCCCC | 31.12 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC21_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC21_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC21_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...