PMT3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PMT3_SCHPO
• UniProt AC: O13351
• Protein Name: Ubiquitin-like protein pmt3/smt3
• Gene Name: pmt3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 117
• Subcellular Localization: Nucleus .
• Protein Description: Required for chromosome segregation where it may be involved in microtubule assembly. Loss of smt3 leads to an increase in telomere length..
• Protein Sequence: MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSESPSANI ------CCCCCCCCC	46.94	24763107
4	Phosphorylation	----MSESPSANISD ----CCCCCCCCCCH	19.49	19547744
6	Phosphorylation	--MSESPSANISDAD --CCCCCCCCCCHHC	43.13	29996109
10	Phosphorylation	ESPSANISDADKSAI CCCCCCCCHHCHHCC	26.93	24763107
14	Sumoylation	ANISDADKSAITPTT CCCCHHCHHCCCCCC	43.43	-
15	Phosphorylation	NISDADKSAITPTTG CCCHHCHHCCCCCCC	26.00	21712547
18	Phosphorylation	DADKSAITPTTGDTS HHCHHCCCCCCCCCC	17.82	25720772
20	Phosphorylation	DKSAITPTTGDTSQQ CHHCCCCCCCCCCHH	34.46	21712547
21	Phosphorylation	KSAITPTTGDTSQQD HHCCCCCCCCCCHHC	33.97	21712547
24	Phosphorylation	ITPTTGDTSQQDVKP CCCCCCCCCHHCCCC	29.76	24763107
25	Phosphorylation	TPTTGDTSQQDVKPS CCCCCCCCHHCCCCC	30.50	21712547
30	Sumoylation	DTSQQDVKPSTEHIN CCCHHCCCCCCCEEE	41.35	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PMT3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PMT3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PMT3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLM9_SCHPO	slm9	genetic	18931302
SRS2_SCHPO	srs2	genetic	18931302
BRL1_SCHPO	brl1	physical	17762865
BRL2_SCHPO	brl2	physical	17762865
YG42_SCHPO	rrp2	physical	23828040
YF2C_SCHPO	rrp1	physical	23828040
TPZ1_SCHPO	tpz1	physical	24711392
STN1_SCHPO	stn1	physical	24711392
ULP1_SCHPO	ulp1	genetic	24818994
IF4G_SCHPO	tif471	physical	24818994
TOP1_SCHPO	top1	genetic	21444718

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.