| UniProt ID | STN1_SCHPO | |
|---|---|---|
| UniProt AC | Q0E7J7 | |
| Protein Name | Protein stn1 | |
| Gene Name | stn1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 325 | |
| Subcellular Localization | Nucleus . Chromosome, telomere . | |
| Protein Description | Required for telomere maintenance.. | |
| Protein Sequence | MLENENQLTHQFPTLSRWNPMFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHHSIIRTPKKSYFPKDHAKELLKCIRQMCKLNVQAGFTIEELIIYLKAKELHLPLVHIFNVENEIVENCDGNHILALNFSLQTLLQHGRIVRKSNSVYMLVTSKDIIRFVIPLMASGLLEAHKVQSIVRDSNPMFITLPLSAIAKHICQFLLRTKGKWRQAKKYTWVRDNQFV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of STN1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STN1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STN1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STN1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YCRE_SCHPO | trs130 | genetic | 22681890 | |
| ATP10_SCHPO | atp10 | genetic | 22681890 | |
| YEM8_SCHPO | clr5 | genetic | 22681890 | |
| REXO3_SCHPO | rex3 | genetic | 22681890 | |
| YIQ4_SCHPO | SPAC824.04 | genetic | 22681890 | |
| PPR2_SCHPO | ppr2 | genetic | 22681890 | |
| PAB2_SCHPO | pab2 | genetic | 22681890 | |
| ARP42_SCHPO | arp42 | genetic | 22681890 | |
| POF9_SCHPO | pof9 | genetic | 22681890 | |
| SKI2_SCHPO | SPCC550.03c | genetic | 22681890 | |
| SNT2_SCHPO | snt2 | genetic | 22681890 | |
| ATG17_SCHPO | atg17 | genetic | 22681890 | |
| YLP3_SCHPO | red1 | genetic | 22681890 | |
| YIU1_SCHPO | saf5 | genetic | 22681890 | |
| MDM31_SCHPO | mdm31 | genetic | 22681890 | |
| TPZ1_SCHPO | tpz1 | physical | 24711392 | |
| PMT3_SCHPO | pmt3 | physical | 24925530 | |
| TPZ1_SCHPO | tpz1 | physical | 24925530 | |
| TPZ1_SCHPO | tpz1 | genetic | 24925530 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...