UniProt ID | YOU5_SCHPO | |
---|---|---|
UniProt AC | O74789 | |
Protein Name | Putative serine/threonine-protein phosphatase C26H8.05c | |
Gene Name | SPBC26H8.05c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 348 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MTDLDLDWQLEELENGRLIPESNVVELCQRVRDILIEESNIQWISSPVTICGDIHGQLHDLLELFRIGGSCPGTKYLFLGDFVDRGFYSVETFLLLLTLKCKYPKEMTLIRGNHESRQITQVYGFYDECVRKYGSANVWRYCCEIFDYLSLGALVDGKVFCVHGGLSPSISSIDQIRLLDRKQEVPHEGAMCDLLWSDPEDISGWGLSPRGAGFLFGADVSEVFNRANDLSFIARAHQLVMEGYKIHFSDKDKQYPKFTNEEDSELDSDSASPVDDSPAPGDIITIPEKDKGSVVTVWSAPNYCYRCGNVASILQLDENQTQSFKIFGTASQERSGIPTKRPIADYFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
259 | Phosphorylation | DKQYPKFTNEEDSEL CCCCCCCCCHHCCCC | 48.09 | 27738172 | |
264 | Phosphorylation | KFTNEEDSELDSDSA CCCCHHCCCCCCCCC | 43.25 | 21712547 | |
268 | Phosphorylation | EEDSELDSDSASPVD HHCCCCCCCCCCCCC | 46.20 | 21712547 | |
270 | Phosphorylation | DSELDSDSASPVDDS CCCCCCCCCCCCCCC | 34.30 | 21712547 | |
272 | Phosphorylation | ELDSDSASPVDDSPA CCCCCCCCCCCCCCC | 29.43 | 28889911 | |
348 | Methylation | RPIADYFL------- CCCHHHCC------- | 5.81 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOU5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOU5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOU5_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...