dbPTM

YOU5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YOU5_SCHPO
UniProt AC	O74789
Protein Name	Putative serine/threonine-protein phosphatase C26H8.05c
Gene Name	SPBC26H8.05c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	348
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MTDLDLDWQLEELENGRLIPESNVVELCQRVRDILIEESNIQWISSPVTICGDIHGQLHDLLELFRIGGSCPGTKYLFLGDFVDRGFYSVETFLLLLTLKCKYPKEMTLIRGNHESRQITQVYGFYDECVRKYGSANVWRYCCEIFDYLSLGALVDGKVFCVHGGLSPSISSIDQIRLLDRKQEVPHEGAMCDLLWSDPEDISGWGLSPRGAGFLFGADVSEVFNRANDLSFIARAHQLVMEGYKIHFSDKDKQYPKFTNEEDSELDSDSASPVDDSPAPGDIITIPEKDKGSVVTVWSAPNYCYRCGNVASILQLDENQTQSFKIFGTASQERSGIPTKRPIADYFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
259	Phosphorylation	DKQYPKFTNEEDSEL CCCCCCCCCHHCCCC	48.09	27738172
264	Phosphorylation	KFTNEEDSELDSDSA CCCCHHCCCCCCCCC	43.25	21712547
268	Phosphorylation	EEDSELDSDSASPVD HHCCCCCCCCCCCCC	46.20	21712547
270	Phosphorylation	DSELDSDSASPVDDS CCCCCCCCCCCCCCC	34.30	21712547
272	Phosphorylation	ELDSDSASPVDDSPA CCCCCCCCCCCCCCC	29.43	28889911
348	Methylation	RPIADYFL------- CCCHHHCC-------	5.81	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YOU5_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YOU5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YOU5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL16C_SCHPO	rpl1603	genetic	18818364
PLMT_SCHPO	cho1	genetic	18818364
CLR4_SCHPO	clr4	genetic	18818364
RSC1_SCHPO	rsc1	genetic	18818364
RIK1_SCHPO	rik1	genetic	18818364
RPA12_SCHPO	rpa12	genetic	18818364
ERS1_SCHPO	ers1	genetic	18818364
DCR1_SCHPO	dcr1	genetic	18818364
JHD1_SCHPO	epe1	genetic	18818364
VPH2_SCHPO	vph2	genetic	18818364
ALP14_SCHPO	alp14	genetic	18818364
RAF2_SCHPO	raf2	genetic	18818364
RIK1_SCHPO	rik1	genetic	22681890
ARB1_SCHPO	arb1	genetic	22681890
SWI6_SCHPO	swi6	genetic	22681890
RAF2_SCHPO	raf2	genetic	22681890
FEP1_SCHPO	fep1	genetic	22681890
CLR4_SCHPO	clr4	genetic	22681890
CHP1_SCHPO	chp1	genetic	22681890
YC1B_SCHPO	msy1	genetic	22681890
AATC_SCHPO	SPAC10F6.13c	genetic	22681890
SCS7_SCHPO	scs7	genetic	22681890
APQ12_SCHPO	apq12	genetic	22681890
CYB51_SCHPO	SPBC29A10.16c	genetic	22681890
YCF8_SCHPO	SPCC1393.08	genetic	22681890
AZET_SCHPO	aca1	genetic	22681890
RAF1_SCHPO	raf1	genetic	22681890
RDP1_SCHPO	rdp1	genetic	22681890
YJ53_SCHPO	SPCC4F11.03c	genetic	22681890
DOP1_SCHPO	SPAPB21F2.02	genetic	22681890
RAD21_SCHPO	rad21	genetic	28438891

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YOU5_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-272, AND MASSSPECTROMETRY.	18257517 [Abstract]