RL16C_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL16C_SCHPO
• UniProt AC: O43004
• Protein Name: 60S ribosomal protein L16-C
• Gene Name: rpl1603
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 197
• Protein Sequence: MSEFQKLVIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFTKAVRGMLPHKTTRGNIALKNLQALEGIPPPFDKQKRLVVPAALRVLRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKSAAFYQAKSANQKHINVAKTKSSVNEKLAVFGY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	Phosphorylation	KACRYNPSRGAFHFR HHHHCCCCCCCCCCC	39.44	25720772
144	Phosphorylation	CTIGRLSSEVGWKYK EEHHHHCHHHCCHHH	40.67	18257517
165	Phosphorylation	EERRKIKSAAFYQAK HHHHCHHHHHHHHHH	28.44	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL16C_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL16C_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL16C_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YOFG_SCHPO	SPBP4H10.16c	genetic	18818364
CCR4_SCHPO	ccr4	genetic	18818364
MTO1_SCHPO	SPBC30B4.06c	genetic	22681890
RAD57_SCHPO	rad57	genetic	22681890
EMC1_SCHPO	emc1	genetic	22681890
MCL1_SCHPO	mcl1	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.