UniProt ID | RL16C_SCHPO | |
---|---|---|
UniProt AC | O43004 | |
Protein Name | 60S ribosomal protein L16-C | |
Gene Name | rpl1603 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 197 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSEFQKLVIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFTKAVRGMLPHKTTRGNIALKNLQALEGIPPPFDKQKRLVVPAALRVLRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKSAAFYQAKSANQKHINVAKTKSSVNEKLAVFGY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Phosphorylation | KACRYNPSRGAFHFR HHHHCCCCCCCCCCC | 39.44 | 25720772 | |
144 | Phosphorylation | CTIGRLSSEVGWKYK EEHHHHCHHHCCHHH | 40.67 | 18257517 | |
165 | Phosphorylation | EERRKIKSAAFYQAK HHHHCHHHHHHHHHH | 28.44 | 27738172 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL16C_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL16C_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL16C_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YOFG_SCHPO | SPBP4H10.16c | genetic | 18818364 | |
CCR4_SCHPO | ccr4 | genetic | 18818364 | |
MTO1_SCHPO | SPBC30B4.06c | genetic | 22681890 | |
RAD57_SCHPO | rad57 | genetic | 22681890 | |
EMC1_SCHPO | emc1 | genetic | 22681890 | |
MCL1_SCHPO | mcl1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...