UniProt ID | ARB1_SCHPO | |
---|---|---|
UniProt AC | Q9P7B8 | |
Protein Name | Argonaute-binding protein 1 | |
Gene Name | arb1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 399 | |
Subcellular Localization | Nucleus . Cytoplasm . Predominantly nuclear. | |
Protein Description | Component of the argonaute siRNA chaperone (ARC) complex which is required for histone H3K9 methylation, heterochromatin assembly and siRNA generation. The ARC complex contains mostly double-stranded siRNA. Inhibits the release of the siRNA passenger strand from ago1 together with arb2. Inhibits the slicer activity of ago1. Required for swi6 localization to the centromeric repeats.. | |
Protein Sequence | MAEGDFKNDSTGCIGDSVEFTTFKKRTGKSLGNRRKKRGLSGWEPYFQEPELTAEEKLENETLYSRNIPLTVRMERFIQRYRSRRKWSDPTRIRLFTMYLDLGGVSTGQKQFTGGTDINNDAKAREVSAQTTTDYIEYDILDEYDIDFKWVAGVFLSSHILYNAGLTKEEDLQIACQIVRNFLLSVLHNNVAPEFEDNIRDACLLAEQAETELISNKRLSTKLPGRLQRALASIHVDNYKGLWDKSQSDRTSDSSVNFIESNNTKFMPNDELFEPDGISRFSTQQARDYIQRTLGPRYLTGKVVEQEYLTVKLVSKTLLNFSNQSLCKAVFIVWDPPGSKYSQDTNKERLEVILESDLLNNTVDGTHLEGSFTFLDNGLTILDTVLAVLPTFYEEVKDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ARB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARB1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARB1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MST2_SCHPO | mst2 | genetic | 21289066 | |
TAS3_SCHPO | tas3 | physical | 26771498 | |
AGO1_SCHPO | ago1 | physical | 25730778 | |
AGO1_SCHPO | ago1 | genetic | 25730778 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...