dbPTM

RHO3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RHO3_SCHPO
UniProt AC	O13928
Protein Name	GTP-binding protein rho3
Gene Name	rho3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	205
Subcellular Localization	Cell membrane Lipid-anchor . Found at the cell periphery and the growing tips of interphase cells. Localized to the division site during cell division.
Protein Description	Involved in controlling cell shape and septation. Regulates cell separation by modulating the function of the exocyst complex. Involved in post-Golgi vesicle transport..
Protein Sequence	MSSCFGSKKKPIYRKIVILGDGAAGKTSLLNVFTKGYFPQVYEPTIFENYIHDIFVDGNSIELSLWDTAGQEEYDQLRSLSYSDTHVIMICFAVDSRDSLENVITKWLPEVSSNCPGVKLVLVALKCDLRGADEEQVDHSKIIDYEEGLAAAKKINAVRYLECSAKLNRGVNEAFTEAARVALAAQPRGTKDGADESHGTGCIIA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
202	Methylation	DESHGTGCIIA---- CCCCCCCCEEC----	1.72	-
202	Geranylgeranylation	DESHGTGCIIA---- CCCCCCCCEEC----	1.72	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RHO3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RHO3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RHO3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC8_SCHPO	sec8	genetic	12930742
EXO70_SCHPO	exo70	genetic	12930742
FOR3_SCHPO	for3	physical	12415007
SCD1_SCHPO	scd1	physical	14637153
GEF3_SCHPO	gef3	physical	24947517

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RHO3_SCHPO

Related Literatures of Post-Translational Modification