UniProt ID | RHO3_SCHPO | |
---|---|---|
UniProt AC | O13928 | |
Protein Name | GTP-binding protein rho3 | |
Gene Name | rho3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 205 | |
Subcellular Localization |
Cell membrane Lipid-anchor . Found at the cell periphery and the growing tips of interphase cells. Localized to the division site during cell division. |
|
Protein Description | Involved in controlling cell shape and septation. Regulates cell separation by modulating the function of the exocyst complex. Involved in post-Golgi vesicle transport.. | |
Protein Sequence | MSSCFGSKKKPIYRKIVILGDGAAGKTSLLNVFTKGYFPQVYEPTIFENYIHDIFVDGNSIELSLWDTAGQEEYDQLRSLSYSDTHVIMICFAVDSRDSLENVITKWLPEVSSNCPGVKLVLVALKCDLRGADEEQVDHSKIIDYEEGLAAAKKINAVRYLECSAKLNRGVNEAFTEAARVALAAQPRGTKDGADESHGTGCIIA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC8_SCHPO | sec8 | genetic | 12930742 | |
EXO70_SCHPO | exo70 | genetic | 12930742 | |
FOR3_SCHPO | for3 | physical | 12415007 | |
SCD1_SCHPO | scd1 | physical | 14637153 | |
GEF3_SCHPO | gef3 | physical | 24947517 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...