| UniProt ID | CWC2_SCHPO | |
|---|---|---|
| UniProt AC | P87126 | |
| Protein Name | Pre-mRNA-splicing factor cwf2 | |
| Gene Name | cwf2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 388 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in the first step of pre-mRNA splicing. Required for cell growth and cell cycle control. Plays a role in the levels of the U1, U4, U5 and U6 snRNAs and the maintenance of the U4/U6 snRNA complex. May provide the link between the "nineteen complex" NTC spliceosome protein complex and the spliceosome through the U6 snRNA. Associates predominantly with U6 snRNAs in assembled active spliceosomes. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle (By similarity). Involved in pre-mRNA splicing.. | |
| Protein Sequence | MSENGLEQEVTVEEKNNDVTEKILVEGEKSKEYEETPRKVKIVKRKKQPARKQIETRPEYEMEPEQPGQVYNLWYNKWSGGMRQDPLKSQVKSETRCVISRDSGYTKADKNPGSFFCLYFARGMCSEGSKCEYLHRLPKDTDFFNANVDCFGREKHADYRDDMGGVGSFLRQNYTLYVGGITPTDDIEEIVSRHFAEWGDIERIRVLNSRGIAFITYLNEANAQFAKEAMAHQSLDHDECLNVRWATTDPNPASQARNQRRLEERAANAVKKLLPKQFLLDLEETKNGKSGNRKRKLELEFGLKGYVPSDDLLYADGANSVHNQLAANEFPNKSQSEEGSNDDHKSVTTTESQNKFVNSQILSDLQVAKQAVHTNQSALVSYYDSDED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSENGLEQE ------CCCCCCEEE | 39.51 | 24763107 | |
| 30 | Phosphorylation | ILVEGEKSKEYEETP EEEECCCCCCCCCCC | 26.81 | 29996109 | |
| 36 | Phosphorylation | KSKEYEETPRKVKIV CCCCCCCCCCCEEEE | 19.22 | 29996109 | |
| 334 | Phosphorylation | ANEFPNKSQSEEGSN HCCCCCCHHCCCCCC | 45.65 | 21712547 | |
| 336 | Phosphorylation | EFPNKSQSEEGSNDD CCCCCHHCCCCCCCC | 44.71 | 25720772 | |
| 340 | Phosphorylation | KSQSEEGSNDDHKSV CHHCCCCCCCCCCCC | 40.12 | 25720772 | |
| 359 | Phosphorylation | SQNKFVNSQILSDLQ HHHHHHCHHHHHHHH | 17.19 | 25720772 | |
| 383 | Phosphorylation | QSALVSYYDSDED-- CCCEEEEECCCCC-- | 11.06 | 21712547 | |
| 385 | Phosphorylation | ALVSYYDSDED---- CEEEEECCCCC---- | 27.12 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC2_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
