UniProt ID | LUC7_SCHPO | |
---|---|---|
UniProt AC | Q9USM4 | |
Protein Name | U1 snRNP-associated protein usp106 | |
Gene Name | usp106 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 264 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the U1 snRNP particle, which recognizes and binds the 5'-splice site of pre-mRNA. Together with other non-snRNP factors, U1 snRNP forms the spliceosomal commitment complex, that targets pre-mRNA to the splicing pathway.. | |
Protein Sequence | MAAEQRKIIEQLMGSNLSNFTSRGLVHFTDRKVCRSFLCGICPHDIFTNTKMDLGPCPKIHSDKLKSDYERASYSHDYGYEWDYLEDLERHVDDCNKRIDIAEARREKTKEEEERIDELMRDIIHTDHSIEVIITEMEALAKRKLVNDAVKHFIELNRLKTYRKELYDEVISMNEIPSQASTTHQKLQVCDICSAYLSRLDNDRRLADHFSGKMHLGYAMLRNIARDLRAQLEDREKSRDKKDGEKQRDNLASFEDKISTSFVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of LUC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LUC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LUC7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LUC7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KA113_SCHPO | kap113 | genetic | 22681890 | |
YJ23_SCHPO | SPCC4B3.03c | genetic | 22681890 | |
SKI2_SCHPO | SPCC550.03c | genetic | 22681890 | |
MU117_SCHPO | mug117 | genetic | 22681890 | |
YJC7_SCHPO | SPCC736.07c | genetic | 22681890 | |
FMNR_SCHPO | SPCC4B3.06c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...