FMNR_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FMNR_SCHPO
• UniProt AC: Q9USJ6
• Protein Name: NAD(P)H-dependent FMN reductase C4B3.06c
• Gene Name: SPCC4B3.06c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 200
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Has several reductase activities that are NAD(P)H-dependent and involve FMN as a cofactor. May be involved in ferric iron assimilation (By similarity)..
• Protein Sequence: MTLPEKLLKITPKILVIMGSVRSKRLCPTIATWVGEMGKRETNFDYEKVDLTDWPLSMSDEPGLPIMGIDVYTQEHTKAWGSKIAGADGFVFVTPQYNGGYPAILKNALDHLYHEWNGKPLLIVSYGGHGGGDCASQLKHVAGFLKMRVAPTMPALTLPRDKIVQGVVDPAVEFTKHLGELKKAFGEFSQLFESNPERKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FMNR_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FMNR_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FMNR_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FMNR_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FMNR_SCHPO	SPCC4B3.06c	physical	23695164
FMNR_SCHPO	SPCC4B3.06c	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.