dbPTM

YBB2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YBB2_SCHPO
UniProt AC	O60064
Protein Name	Probable mannose-1-phosphate guanyltransferase
Gene Name	SPBC13G1.02
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	414
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Involved in cell wall synthesis where it is required for glycosylation..
Protein Sequence	MISSAVILVGGPSRGTRFRPLSFDVPKPLFKIGGREMIYHHLAALSKIESVKDVFLVGFYDESVFKDFINEVASHFPSFNRIKYLREYNCLGTGGGLYHFRDQILKGHTSNVFVMHADVCCSFPLQELLNVHHEKKALVTLMATKVSKEDASNFGCLVEEPSTGRVLHYVDKPSSYLSNIISCGIYIFDASIFDEIKKAYERRLEEVEKQLRSLDEGMEDYLSLETDVLAPLCSDSSKAIYAYNTPEFWRQIKTAGSAVPANSLYLQKAYHDGTLPKPDTEAEIIQPVFIHPNAIVSKGAKIGPNVSIGARVRIEDGARIRNSIIQEDCEISANAVVLHSILSRHCKIGKWSRVEGSPTLPSQHSTTIMRNSVKVQAITVMGADCIVHDEVRVQNCLVLPHKEIKVGLVGEIVM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
357	Phosphorylation	KWSRVEGSPTLPSQH CEECCCCCCCCCCCC	10.95	29996109
359	Phosphorylation	SRVEGSPTLPSQHST ECCCCCCCCCCCCCC	53.66	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YBB2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YBB2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YBB2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YBB2_SCHPO	mpg2	physical	22416758
MPG1_SCHPO	mpg1	genetic	22416758

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YBB2_SCHPO

Related Literatures of Post-Translational Modification