UniProt ID | YPT1_SCHPO | |
---|---|---|
UniProt AC | P11620 | |
Protein Name | GTP-binding protein ypt1 | |
Gene Name | ypt1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 203 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . Golgi apparatus membrane Peripheral membrane protein . Cytoplasm . Preautophagosomal structure membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Ypt1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.. | |
Protein Sequence | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTFELEGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLQEIDRYAVEGVNRLLVGNKSDMVDKKVVEYSVAKEFADSLNIPFLETSAKDSTNVEQAFLTMSRQIKERMGNNTFASSNAKSSVKVGQGTNVSQSSSNCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | GDSGVGKSCLLLRFA CCCCCCCCEEEEEEC | 12.22 | 25720772 | |
142 | Phosphorylation | VAKEFADSLNIPFLE HHHHHHHHCCCCEEC | 21.64 | 25720772 | |
164 | Phosphorylation | NVEQAFLTMSRQIKE CHHHHHHHHHHHHHH | 13.47 | 28889911 | |
181 | Phosphorylation | GNNTFASSNAKSSVK CCCCCCCCCCCCCEE | 37.06 | 24763107 | |
185 | Phosphorylation | FASSNAKSSVKVGQG CCCCCCCCCEEECCC | 37.64 | 25720772 | |
186 | Phosphorylation | ASSNAKSSVKVGQGT CCCCCCCCEEECCCC | 25.83 | 25720772 | |
202 | Geranylgeranylation | VSQSSSNCC------ CCCCCCCCC------ | 2.92 | 1597466 | |
202 | Geranylgeranylation | VSQSSSNCC------ CCCCCCCCC------ | 2.92 | 1597466 | |
203 | Geranylgeranylation | SQSSSNCC------- CCCCCCCC------- | 7.96 | 1597466 | |
203 | Geranylgeranylation | SQSSSNCC------- CCCCCCCC------- | 7.96 | 1597466 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPT1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPT1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPT1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YPT1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-164, AND MASSSPECTROMETRY. | |
Prenylation | |
Reference | PubMed |
"Post-translational processing of Schizosaccharomyces pombe YPTproteins."; Newman C.M., Giannakouros T., Hancock J.F., Fawell E.H., Armstrong J.,Magee A.I.; J. Biol. Chem. 267:11329-11336(1992). Cited for: ISOPRENYLATION AT CYS-202 AND CYS-203. |