MUG64_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUG64_SCHPO
• UniProt AC: Q10253
• Protein Name: Meiotically up-regulated gene 64 protein
• Gene Name: mug64
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 286
• Subcellular Localization: Cytoplasm .
• Protein Description: Has a role in meiosis..
• Protein Sequence: METFKTHITGQFNATVSSITPFAKKTTHYLRTKIGSRVEELSLPEDYVELEQQVDSLKEAYNLVLPIVETVEVDGYDYPTNFRDSITDFGKTVSGKVRNLGNLTPLEQTPLASVGKNLEEKEAAAKPSRTLYNAISRAASEATTKMGAGNPLSSAFGQISVLEEKVGNLQGERDSAISKNFCEQVRAVLYPRFAEAHRVKADVQDKRLQLEMAKLDVESAKPENLEHCKSAVRSAEDELNGAIEHAKILYEQILNKDYNTDLLRSIIKNQLKFHQDAAAALSDITI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
92	Phosphorylation	SITDFGKTVSGKVRN HCCCCCHHHCCCCCC	21.93	25720772
104	Phosphorylation	VRNLGNLTPLEQTPL CCCCCCCCCCCCCCC	29.81	28889911
109	Phosphorylation	NLTPLEQTPLASVGK CCCCCCCCCCHHHCC	15.76	24763107
113	Phosphorylation	LEQTPLASVGKNLEE CCCCCCHHHCCCHHH	38.80	25720772
282	Phosphorylation	QDAAAALSDITI--- HHHHHHHHCCCC---	23.41	25720772
285	Phosphorylation	AAALSDITI------ HHHHHCCCC------	26.14	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUG64_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUG64_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUG64_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of MUG64_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.