dbPTM

INI1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	INI1_SCHPO
UniProt AC	Q9UTB8
Protein Name	Pre-mRNA-splicing factor ini1
Gene Name	ini1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	117
Subcellular Localization	Nucleus .
Protein Description	Required for pre-mRNA splicing..
Protein Sequence	MSKHHPDLVLCRRQPGITVGKLCERCDEKCPICDSHVRPTTLVRICDECAFGSSQDRCIICGAPGVSDCYYCSECTRMEYDRDGCPRVINLGSSRTDWFYERKKFKNAGKEMPGATY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
53	Phosphorylation	CDECAFGSSQDRCII CCCCCCCCCCCCEEE	20.55	25720772
54	Phosphorylation	DECAFGSSQDRCIIC CCCCCCCCCCCEEEC	36.16	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of INI1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of INI1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of INI1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
WEE1_SCHPO	wee1	genetic	14762117
YQJ9_SCHPO	SPCC1840.09	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of INI1_SCHPO

Related Literatures of Post-Translational Modification