| UniProt ID | RU2A_SCHPO | |
|---|---|---|
| UniProt AC | Q9USX8 | |
| Protein Name | U2 small nuclear ribonucleoprotein A' | |
| Gene Name | lea1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 239 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing. This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA (By similarity).. | |
| Protein Sequence | MRLNAEFLSQVPSFISPLKETELDLRWYQIPIIENLGVLRDVHDAIDFTDNDIRYLGNFPRMKRLQTLLCGNNRITAIAPDIGKVLPNLKTLSLAQNHLQEIADLDPLASCPQLTNLSCIDNPVAQKQYYRLYLIWRIPSLHILDFERVRRNERLRAEEVFGQIQNPTEIASSIMGVKSRVFDLAALVQSHPEANSPITTGYTLTPEEREKIKEAIKNASSIAEINRLEAMLLEGKIPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RU2A_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RU2A_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RU2A_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
