dbPTM

RL4A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL4A_SCHPO
UniProt AC	P35679
Protein Name	60S ribosomal protein L4-A
Gene Name	rpl402
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	363
Subcellular Localization
Protein Description
Protein Sequence	MAAARPTVSIYSKDGSVSSETIALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAFGNMCRSGRMFAPTKTWRKWHVKVNQNEKRYAISSAVAASGVPSLLLARGHRIEEIPEVPLVVDDAVQSFQKTKEAVALLKEIKAYRDVVKVANSRKLRAGKGKLRNRRHVQRRGPLVVFNEDAGIVKAFRNIPGVEIVNVRRLNLLQLAPGGHLGRFVIWTKSAFGLLDSVFGSTTEAAQLKKNYFLPENIISNADVTRLINSDEIQSIVKAAGPSRVKRAHVQKKNPLKNKAVLARLNPYAKAYKANVKLNTGKTPKAAGEKFLTVLHEN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	ARPTVSIYSKDGSVS CCCEEEEEECCCCCC	11.36	18257517
16	Phosphorylation	SIYSKDGSVSSETIA EEEECCCCCCCCEEE	29.03	28889911
18	Phosphorylation	YSKDGSVSSETIALP EECCCCCCCCEEEEC	24.93	21712547
21	Phosphorylation	DGSVSSETIALPFVF CCCCCCCEEEECEEE	17.31	27738172
55	Phosphorylation	KRQPYAVSEKAGHQT CCCCCEEECCCCCCC	25.80	24763107
87	Phosphorylation	GGGGTHRSGQAAFGN CCCCCCCCCHHHCCC	27.87	28889911
160	Phosphorylation	VVDDAVQSFQKTKEA EECHHHHHHHHHHHH	24.05	25720772
255	Phosphorylation	RFVIWTKSAFGLLDS EEEEEEHHHHHHHHH	22.81	25720772
266	Phosphorylation	LLDSVFGSTTEAAQL HHHHHHCCHHHHHHH	22.23	25720772
277	Phosphorylation	AAQLKKNYFLPENII HHHHHHHCCCCCHHC	18.51	25720772
285	Phosphorylation	FLPENIISNADVTRL CCCCHHCCCCCHHHH	23.36	25720772
295	Phosphorylation	DVTRLINSDEIQSIV CHHHHCCHHHHHHHH	29.62	28889911
300	Phosphorylation	INSDEIQSIVKAAGP CCHHHHHHHHHHHCH	34.70	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL4A_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL4A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL4A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RL4A_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL4A_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-87, AND MASSSPECTROMETRY.	18257517 [Abstract]