dbPTM

RL25A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL25A_SCHPO
UniProt AC	Q10330
Protein Name	60S ribosomal protein L25-A
Gene Name	rpl2501
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	141
Subcellular Localization
Protein Description	This protein binds to a specific region on the 26S rRNA..
Protein Sequence	MSVAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSVAHAPRLDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	KVAKKVRTSTTFRRP HHHHHHCCCCCCCCC	33.15	25720772
28	Phosphorylation	VAKKVRTSTTFRRPK HHHHHCCCCCCCCCC	18.19	29996109
29	Phosphorylation	AKKVRTSTTFRRPKT HHHHCCCCCCCCCCC	29.37	25720772
49	Phosphorylation	KPKYARKSVAHAPRL CCCCCCHHHCCCCCC	20.98	24763107
68	Phosphorylation	IIVNPINSESAMKKI EEEECCCCHHHHHHH	33.38	28889911
70	Phosphorylation	VNPINSESAMKKIED EECCCCHHHHHHHCC	33.22	28889911
103	Phosphorylation	EAVRKLYSVEPVKIN HHHHHHHCCCCEEEE	30.36	25720772
126	Phosphorylation	KKAFVKLSADADALD CEEEEEECCCHHHHH	20.56	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL25A_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL25A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL25A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RL25A_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL25A_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-68 AND SER-70, AND MASSSPECTROMETRY.	18257517 [Abstract]