| UniProt ID | RL25A_SCHPO | |
|---|---|---|
| UniProt AC | Q10330 | |
| Protein Name | 60S ribosomal protein L25-A | |
| Gene Name | rpl2501 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 141 | |
| Subcellular Localization | ||
| Protein Description | This protein binds to a specific region on the 26S rRNA.. | |
| Protein Sequence | MSVAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSVAHAPRLDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | KVAKKVRTSTTFRRP HHHHHHCCCCCCCCC | 33.15 | 25720772 | |
| 28 | Phosphorylation | VAKKVRTSTTFRRPK HHHHHCCCCCCCCCC | 18.19 | 29996109 | |
| 29 | Phosphorylation | AKKVRTSTTFRRPKT HHHHCCCCCCCCCCC | 29.37 | 25720772 | |
| 49 | Phosphorylation | KPKYARKSVAHAPRL CCCCCCHHHCCCCCC | 20.98 | 24763107 | |
| 68 | Phosphorylation | IIVNPINSESAMKKI EEEECCCCHHHHHHH | 33.38 | 28889911 | |
| 70 | Phosphorylation | VNPINSESAMKKIED EECCCCHHHHHHHCC | 33.22 | 28889911 | |
| 103 | Phosphorylation | EAVRKLYSVEPVKIN HHHHHHHCCCCEEEE | 30.36 | 25720772 | |
| 126 | Phosphorylation | KKAFVKLSADADALD CEEEEEECCCHHHHH | 20.56 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL25A_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL25A_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL25A_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RL25A_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...