UniProt ID | YF28_SCHPO | |
---|---|---|
UniProt AC | O13758 | |
Protein Name | Uncharacterized protein C17A2.08c | |
Gene Name | SPAC17A2.08c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 361 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MRRYLKKAKPKIVQTSDNEEEKHEENLNVSQSNKNANRRKTKAKEKNSGKFRVKYENEEGDDDGEDSQIPLIPKVKKQSSFHSVDDLISRRMDALSHESGYSNAYVDELKRKSRQTPSEFTKKEEDSSTKESELQTRSSPPLPVNTSLEWNMLNQGIPEEAMIKELKDREGRKRNIAMMTDNYISLETGDQLMLAQNHKEEKLLQTEDEIQDEGYSGFENYVEESEKLQEIYHHSSESLRTRSIQMAVDQKNMEMELDDEDIAEPIQSWEHTQIKKGAFGESPAFTNGLSVKLPNILTMDEQIQRLKEAIASEKLQQEERSQIIKSLMEEELEINEQEEKIKHSFIDLDKTLLNNLTKSKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | AKPKIVQTSDNEEEK HCCCEEECCCCHHHH | 27.44 | 29996109 | |
16 | Phosphorylation | KPKIVQTSDNEEEKH CCCEEECCCCHHHHH | 22.73 | 25720772 | |
79 | Phosphorylation | IPKVKKQSSFHSVDD CCCCCCCCCCCCHHH | 43.80 | 25720772 | |
80 | Phosphorylation | PKVKKQSSFHSVDDL CCCCCCCCCCCHHHH | 25.20 | 25720772 | |
83 | Phosphorylation | KKQSSFHSVDDLISR CCCCCCCCHHHHHHH | 25.82 | 25720772 | |
136 | Phosphorylation | TKESELQTRSSPPLP CCHHHHCCCCCCCCC | 45.18 | 21712547 | |
138 | Phosphorylation | ESELQTRSSPPLPVN HHHHCCCCCCCCCCC | 51.05 | 29996109 | |
139 | Phosphorylation | SELQTRSSPPLPVNT HHHCCCCCCCCCCCC | 27.52 | 27738172 | |
146 | Phosphorylation | SPPLPVNTSLEWNML CCCCCCCCHHHHHHH | 34.62 | 29996109 | |
147 | Phosphorylation | PPLPVNTSLEWNMLN CCCCCCCHHHHHHHH | 21.06 | 29996109 | |
216 | Phosphorylation | EIQDEGYSGFENYVE HHHHCCCCCHHHHHH | 48.11 | 21712547 | |
232 | Phosphorylation | SEKLQEIYHHSSESL HHHHHHHHHHCCHHH | 7.85 | 29996109 | |
238 | Phosphorylation | IYHHSSESLRTRSIQ HHHHCCHHHHHHHHH | 25.71 | 29996109 | |
243 | Phosphorylation | SESLRTRSIQMAVDQ CHHHHHHHHHHHHHH | 19.29 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YF28_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YF28_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YF28_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YF28_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...