dbPTM

RL13_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL13_SCHPO
UniProt AC	O74175
Protein Name	60S ribosomal protein L13
Gene Name	rpl13
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	208
Subcellular Localization
Protein Description
Protein Sequence	MAIHVKGQLPNAHFHKDWQRYVKTWFNQPGRKLRRRQARQTKAAKIAPRPVEAIRPAVKPPTIRYNMKVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFPRKAGQPKKGDATDVSGAEQTDVAAVLPITQEAVEEAKPITEEAKNFNAFSTLSNERAYARYAGARAAFQKKRAEEAEAKKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
91	Phosphorylation	GVSRRVASTIGIPVD CCCHHHHHHHCCCCC	20.08	28889911
92	Phosphorylation	VSRRVASTIGIPVDH CCHHHHHHHCCCCCH	17.31	29996109
105	Phosphorylation	DHRRRNRSEESLQRN CHHHCCCCHHHHHHH	49.63	28889911
119	Phosphorylation	NVERIKVYLAHLIVF HHHHHHHHHHHHHHC	7.99	25720772
139	Phosphorylation	QPKKGDATDVSGAEQ CCCCCCCCCCCCCCC	41.49	21712547
142	Phosphorylation	KGDATDVSGAEQTDV CCCCCCCCCCCCCCC	34.79	28889911
147	Phosphorylation	DVSGAEQTDVAAVLP CCCCCCCCCCEEEEE	24.77	29996109
177	Phosphorylation	AKNFNAFSTLSNERA HHHCCCCHHCCCHHH	26.48	28889911
178	Phosphorylation	KNFNAFSTLSNERAY HHCCCCHHCCCHHHH	27.96	25720772
180	Phosphorylation	FNAFSTLSNERAYAR CCCCHHCCCHHHHHH	36.41	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL13_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL13_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL13_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL13_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-177 AND SER-180, ANDMASS SPECTROMETRY.	18257517 [Abstract]