dbPTM

RS3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS3_SCHPO
UniProt AC	O60128
Protein Name	40S ribosomal protein S3
Gene Name	rps3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	249
Subcellular Localization
Protein Description
Protein Sequence	MSAAFTISKKRKFVADGVFYAELNEFFTRELSEEGYSGCEVRVTPSRSEIIIRATHTQDVLGEKGRRIRELTALVQKRFKFAENTVELYAEKVQNRGLCAVAQCESLRYKLLAGLAVRRAAYGVLRYVMEAGAKGCEVVISGKLRAARAKSMKFADGFMIHSGQPAVDFIDSATRHVLLRQGVLGVKVKIMLPEPKTRQKKSLPDIVVVLDPKEEEPITKPYTVINQPVEAAAAAGQEVVAEQETAVAY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	EFFTRELSEEGYSGC HHHHHHHHHCCCCCC	28.93	28889911
37	Phosphorylation	ELSEEGYSGCEVRVT HHHHCCCCCCEEEEC	48.07	28889911
46	Phosphorylation	CEVRVTPSRSEIIIR CEEEECCCCCEEEEE	38.79	29996109
48	Phosphorylation	VRVTPSRSEIIIRAT EEECCCCCEEEEEEE	37.17	29996109
106	Phosphorylation	CAVAQCESLRYKLLA HHHHCCHHHHHHHHH	26.27	28889911
122	Phosphorylation	LAVRRAAYGVLRYVM HHHHHHHHHHHHHHH	13.54	25720772
141	Phosphorylation	KGCEVVISGKLRAAR CCCEEEECCCCHHHH	20.47	28889911
202	Phosphorylation	PKTRQKKSLPDIVVV CCCCCCCCCCCEEEE	52.77	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YNW5_SCHPO	yar1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS3_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32; SER-37; SER-106 ANDSER-141, AND MASS SPECTROMETRY.	18257517 [Abstract]