SAP62_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAP62_SCHPO
• UniProt AC: Q9P7L8
• Protein Name: Pre-mRNA-splicing factor sap62
• Gene Name: sap62
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 217
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome..
• Protein Sequence: MDYQNRAGVRFGGGGVAGYQETNAARRERLRKLALETIDLSKDPYLMKNHLGTFECRLCLTTHANENSYLTHTQGKKHQTNLARRQALENKKSQENAPQVLLGISQSHVQVKKSVVKIGRPGYKVSKIREAESGKFGLRFQIKYPDIEVNAKPRYRIMSAYEQRVEAPDRKFQYLVVAAEPYESIAFKIDRAPGKFWSYWDAPTYTIQFFYNLTKIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SAP62_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAP62_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAP62_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAP62_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YIW4_SCHPO	SPAC694.04c	genetic	22681890
ARP8_SCHPO	arp8	genetic	22681890
SNF5_SCHPO	snf5	genetic	22681890
YAQD_SCHPO	SPAC18G6.13	genetic	22681890
SOL1_SCHPO	sol1	genetic	22681890
POF3_SCHPO	pof3	genetic	22681890
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.