UniProt ID | SPI1_SCHPO | |
---|---|---|
UniProt AC | P28748 | |
Protein Name | GTP-binding nuclear protein spi1 | |
Gene Name | spi1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus. | |
Protein Description | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export.. | |
Protein Sequence | MAQPQNVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFHTNFGEICFNVWDTAGQEKLGGLRDGYYIQGQCGIIMFDVTSRITYKNVPHWWRDLVRVCENIPIVLCGNKVDVKERKVKAKAITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPNLEFVASPALAPPEVQVDQQLLAQYQQEMNEAAAMPLPDEDDADL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPI1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPI1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPI1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DIS3_SCHPO | dis3 | physical | 8896453 | |
RCC1_SCHPO | pim1 | genetic | 11086011 | |
NDC1_SCHPO | cut11 | genetic | 11086011 | |
MAL3_SCHPO | mal3 | genetic | 11086011 | |
RCC1_SCHPO | pim1 | physical | 8887664 | |
RANG_SCHPO | sbp1 | physical | 11086011 | |
RCC1_SCHPO | pim1 | physical | 16371130 | |
FFT3_SCHPO | fft3 | physical | 18422602 | |
SPC7_SCHPO | spc7 | genetic | 15371542 | |
CSE1_SCHPO | kap109 | physical | 26771498 | |
XPOT_SCHPO | los1 | physical | 26771498 | |
MOG1_SCHPO | mog1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...