dbPTM

RANG_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RANG_SCHPO
UniProt AC	Q09717
Protein Name	Ran-specific GTPase-activating protein 1
Gene Name	sbp1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	215
Subcellular Localization	Cytoplasm. Mainly cytoplasmic.
Protein Description	Stimulates the GTPase activity in the presence of RNA1. May potentiate the action of RanGAP1 (RNA1), thus playing the role of a negative regulator..
Protein Sequence	MSAEQEKKTQGTTKEEQKSSFASEDVASKQTEEAKAVFGDGVAKQENKSGASTNDEKKPAEGDEDAEPASPEVHFEPIVKLSAVETKTNEEEETVEFKMRAKLFRFDKAASEWKERGTGDARLLKHKETGKTRLVMRRDKTLKVCANHLLMPEMKLTPNVGSDRSWVWTVAADVSEGEPTAETFAIRFANSENANLFKENFEKYQEENAKILKKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	TTKEEQKSSFASEDV CCHHHHHHHHCCHHH	30.31	25720772
20	Phosphorylation	TKEEQKSSFASEDVA CHHHHHHHHCCHHHH	31.69	25720772
23	Phosphorylation	EQKSSFASEDVASKQ HHHHHHCCHHHHHHH	32.11	25720772
49	Phosphorylation	VAKQENKSGASTNDE CCCCCCCCCCCCCCC	51.69	29996109
52	Phosphorylation	QENKSGASTNDEKKP CCCCCCCCCCCCCCC	31.13	28889911
53	Phosphorylation	ENKSGASTNDEKKPA CCCCCCCCCCCCCCC	46.27	29996109
70	Phosphorylation	DEDAEPASPEVHFEP CCCCCCCCCCCCCEE	32.10	28889911
86	Phosphorylation	VKLSAVETKTNEEEE EEEEEEECCCCCCCH	36.25	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RANG_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RANG_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RANG_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SPI1_SCHPO	spi1	physical	9504913

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RANG_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70, AND MASSSPECTROMETRY.	18257517 [Abstract]