MOG1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOG1_SCHPO
• UniProt AC: O75002
• Protein Name: Nuclear import protein mog1
• Gene Name: mog1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 190
• Subcellular Localization: Nucleus .
• Protein Description: Involved in the Ran-GTPase system for nuclear protein import and poly(A)+ mRNA export. Required for mitosis-to-interphase transition..
• Protein Sequence: MVQLFGGALCADFPPKFLDASVLRQIPDNQEVFLQDSKENLTVIIELLEKIEKPFDGSVAAYHFNSIAFDNDASQRVIWRDKSLGEDDFEGMRSEKASGSSVQGCQRVLEKGKRNPESATNVAIFVNVITLIDFQTDIVISVNAPLPNTSSVPSSVENIPPSDQSIVRAALETIQRVTRSLVLVDKTVFA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
83	Phosphorylation	RVIWRDKSLGEDDFE CEEEECCCCCCCCCC	45.99	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOG1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOG1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOG1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NTF2_SCHPO	nxt2	physical	17651922
SPI1_SCHPO	spi1	physical	17651922
CID13_SCHPO	cid13	physical	17651922
SPI1_SCHPO	spi1	genetic	11290708
SPI1_SCHPO	spi1	genetic	17651922
CID13_SCHPO	cid13	genetic	17651922
PABPX_SCHPO	crp79	genetic	17651922
YGVA_SCHPO	def1	genetic	17651922
SSP1_SCHPO	ssp1	genetic	17651922
NTF2_SCHPO	nxt2	genetic	17651922
MOG1_SCHPO	mog1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.