UniProt ID | MOG1_SCHPO | |
---|---|---|
UniProt AC | O75002 | |
Protein Name | Nuclear import protein mog1 | |
Gene Name | mog1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 190 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in the Ran-GTPase system for nuclear protein import and poly(A)+ mRNA export. Required for mitosis-to-interphase transition.. | |
Protein Sequence | MVQLFGGALCADFPPKFLDASVLRQIPDNQEVFLQDSKENLTVIIELLEKIEKPFDGSVAAYHFNSIAFDNDASQRVIWRDKSLGEDDFEGMRSEKASGSSVQGCQRVLEKGKRNPESATNVAIFVNVITLIDFQTDIVISVNAPLPNTSSVPSSVENIPPSDQSIVRAALETIQRVTRSLVLVDKTVFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
83 | Phosphorylation | RVIWRDKSLGEDDFE CEEEECCCCCCCCCC | 45.99 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOG1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOG1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOG1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NTF2_SCHPO | nxt2 | physical | 17651922 | |
SPI1_SCHPO | spi1 | physical | 17651922 | |
CID13_SCHPO | cid13 | physical | 17651922 | |
SPI1_SCHPO | spi1 | genetic | 11290708 | |
SPI1_SCHPO | spi1 | genetic | 17651922 | |
CID13_SCHPO | cid13 | genetic | 17651922 | |
PABPX_SCHPO | crp79 | genetic | 17651922 | |
YGVA_SCHPO | def1 | genetic | 17651922 | |
SSP1_SCHPO | ssp1 | genetic | 17651922 | |
NTF2_SCHPO | nxt2 | genetic | 17651922 | |
MOG1_SCHPO | mog1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...