UniProt ID | DYLT_SCHPO | |
---|---|---|
UniProt AC | Q9UTS6 | |
Protein Name | Dynein light chain Tctex-type | |
Gene Name | dlc1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 111 | |
Subcellular Localization | Cytoplasm, cytoskeleton . | |
Protein Description | Acts as a non-catalytic accessory component of a dynein complex.. | |
Protein Sequence | MSCPIDSKKLEEICLEAAQPVLKASEYDGDKTAEMNQSVIYAVLNALNKETQSYKWIVSSTLVQKLPEDHPSRGVHAAHAACWNCEKDGMTTIKESGEAIDVVLSIMWISI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | VLSIMWISI------ EEEHHEECC------ | 13.51 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYLT_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYLT_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYLT_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KMS1_SCHPO | kms1 | physical | 14655046 | |
YE57_SCHPO | csi2 | genetic | 22681890 | |
BDC1_SCHPO | bdc1 | genetic | 22681890 | |
6PGL_SCHPO | SPCC16C4.10 | genetic | 22681890 | |
SWD3_SCHPO | swd3 | genetic | 22681890 | |
CLR4_SCHPO | clr4 | genetic | 22681890 | |
ULP2_SCHPO | ulp2 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
PNK1_SCHPO | pnk1 | genetic | 22681890 | |
CAPZB_SCHPO | acp2 | genetic | 22681890 | |
NACB_SCHPO | btf3 | genetic | 22681890 | |
RDH54_SCHPO | rdh54 | genetic | 22681890 | |
PTPA1_SCHPO | ypa1 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
MID1_SCHPO | mid1 | genetic | 22681890 | |
MKH1_SCHPO | mkh1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...