ARF6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARF6_SCHPO
• UniProt AC: Q9Y7Z2
• Protein Name: ADP-ribosylation factor 6
• Gene Name: arf6
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 184
• Subcellular Localization: Cell membrane ; Peripheral membrane protein . Cell septum . Localizes at both cell ends and presumptive septa in a cell-cycle dependent manner.
• Protein Description: GTP-binding protein that functions as a molecular switch for the activation of 'new end take off' (NETO), a process in which the directions of cell growth change from a monopolar manner to a bipolar manner in fission yeast. Involved in supplying membrane to the growing new end..
• Protein Sequence: MGNSLFKGFSKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGNSLFKGF ------CCCCHHCCC	32.22	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARF6_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARF6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARF6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARF6_SCHPO	arf6	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.