BSCLH_SCHPO - dbPTM
BSCLH_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID BSCLH_SCHPO
UniProt AC O14119
Protein Name Seipin homolog {ECO:0000250|UniProtKB:Q06058}
Gene Name SPAC3A11.04 {ECO:0000312|PomBase:SPAC3A11.04}
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 249
Subcellular Localization Endoplasmic reticulum membrane
Multi-pass membrane protein . Concentrates at endoplasmic reticulum lipid droplet junctions.
Protein Description Involved in lipid metabolism and lipid droplet (LD) morphology, number, and size. Facilitates initiation of LD formation, and ensures that vectorial budding of LDs from the ER is directed towards the cytoplasm..
Protein Sequence MGYLVKLFKLVVWMLVIGLFSIPSLVSYVIFYDTVIPHSVIQYPVYFNYTTGLNFPTAEVRLDHFSIDPRLPGTSLLQIKMPHSPRNSAMGNFMVSVDFQDRNQRSLKQVKRTVLLPHRSPIHEYLKLIVCSPLYFMGILEETDIVNVRLFESETFAKSFNSITTLSVRFSVKNTPAQAIVKIYSKDIEFYEATLAFASKLHGMRWFMYTHKVSAFLVFTSLFWFTGITSTIITYLIVSSTSETKATRR
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of BSCLH_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of BSCLH_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of BSCLH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of BSCLH_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
BSCLH_SCHPOSPAC3A11.04physical
26771498

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of BSCLH_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP