dbPTM

BSCLH_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BSCLH_SCHPO
UniProt AC	O14119
Protein Name	Seipin homolog {ECO:0000250\|UniProtKB:Q06058}
Gene Name	SPAC3A11.04 {ECO:0000312\|PomBase:SPAC3A11.04}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	249
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein . Concentrates at endoplasmic reticulum lipid droplet junctions.
Protein Description	Involved in lipid metabolism and lipid droplet (LD) morphology, number, and size. Facilitates initiation of LD formation, and ensures that vectorial budding of LDs from the ER is directed towards the cytoplasm..
Protein Sequence	MGYLVKLFKLVVWMLVIGLFSIPSLVSYVIFYDTVIPHSVIQYPVYFNYTTGLNFPTAEVRLDHFSIDPRLPGTSLLQIKMPHSPRNSAMGNFMVSVDFQDRNQRSLKQVKRTVLLPHRSPIHEYLKLIVCSPLYFMGILEETDIVNVRLFESETFAKSFNSITTLSVRFSVKNTPAQAIVKIYSKDIEFYEATLAFASKLHGMRWFMYTHKVSAFLVFTSLFWFTGITSTIITYLIVSSTSETKATRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BSCLH_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BSCLH_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BSCLH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BSCLH_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
BSCLH_SCHPO	SPAC3A11.04	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BSCLH_SCHPO

Related Literatures of Post-Translational Modification