YOX1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOX1_SCHPO
• UniProt AC: P40923
• Protein Name: MBF complex negative regulatory component yox1
• Gene Name: yox1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 201
• Subcellular Localization: Nucleus .
• Protein Description: Negative regulatory component of the MBF transcription factor complex involved in cell-cycle G1/S phase-specific gene expression and more particularly DNA replication checkpoint-dependent gene expression..
• Protein Sequence: MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCETSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAAHQELEECARSLVELQQQCNDH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MSLSDSPSKSGNTGK CCCCCCCCCCCCCCC	1.81	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOX1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOX1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOX1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC10_SCHPO	cdc10	genetic	21304269
NRM1_SCHPO	nrm1	physical	21359180
GSF2_SCHPO	gsf2	genetic	23236291

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.