RGA5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGA5_SCHPO
• UniProt AC: O74335
• Protein Name: Rho-GTPase-activating protein 5
• Gene Name: rga5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 361
• Subcellular Localization: Membrane . Membrane-associated. Localizes to the cell poles and septum.
• Protein Description: GTPase-activating protein for Rho1. Has a role in the negative regulation of (1-3)beta-D-glucan synthase activity and cell integrity..
• Protein Sequence: MTVVVGVLQIDDMGKKSSFASWWKQLRVKKSDDNKLFGLSLTRALEVSKVAIFLTRRDGEKVFYGYIPAVVAKCGFFLKQNATQVKGIFRVNGSSKRIQILQKAFSTGPDYGRSFDWEGYTVHDAANVFRRFINLMPEHVIPLEYYERFREPMTIPNLTDNERVEMYRRRIDELPIPNRQLLLYLLDLLSVFAMNSSKNLMTADNLAAIFQPGILSHPDHEVYSKDYQISQTALLFLINHQGSFIKTIPLSSLPPLVAAPTSPNTSSTLITQSAAPTPIASTSIRINSFNPRNGSIKRWRSFSRHSSATYSNSPSSNFSNMKSSEVDPGSPPRIKSRSYSLSRSSSMKLFHTLDRRRENRM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
330	Phosphorylation	SSEVDPGSPPRIKSR CCCCCCCCCCCCCCC	36.80	28889911
340	Phosphorylation	RIKSRSYSLSRSSSM CCCCCCEEECCHHHH	22.55	25720772
346	Phosphorylation	YSLSRSSSMKLFHTL EEECCHHHHHHHHHH	22.60	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RGA5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RGA5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGA5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YOCC_SCHPO	pxl1	genetic	18256290

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.