| UniProt ID | PPX1_SCHPO | |
|---|---|---|
| UniProt AC | O14094 | |
| Protein Name | Putative exopolyphosphatase | |
| Gene Name | SPAC2F3.11 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 384 | |
| Subcellular Localization | ||
| Protein Description | Degradation of inorganic polyphosphates.. | |
| Protein Sequence | MKLGRFLENGREQIRNLLLNASTVSSAPSFSFVSGNESADLDSCASSIVYAYCLQRKQLGRIVVPFFNIPRKELRLRPELSYLLNLASISSDDIVFLDDIVKLPKRIFSNPIYLVDHNSLDRKDLENFNGSIAGIIDHHKDEGGSLHADPRIIEECGSCCTLVCRYFMPVIRSLYDSKVSELHQTATNLAVLALGPILIDTGNLKNEKTTDTDVKIVNDLCSFVPKDWVRDEFFDTLKEKKKSCKGFSFDDLLRRDLKQYFPDGIVVNYASVGKGLDWIKKKRLGWEDELKSFAEVQNSDLVIVGLSLSKNDEFGRQLILYKRTERGAGLADSFLKLSKQNLGLEIIEEKDNGDLSMWNQRNSAASRKKVVPLLMDSVKQVASK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 243 | Phosphorylation | TLKEKKKSCKGFSFD HHHHHHHCCCCCCHH | 29.91 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPX1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPX1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPX1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MPH1L_SCHPO | mph1 | genetic | 22681890 | |
| YQE1_SCHPO | xan1 | genetic | 22681890 | |
| SWD3_SCHPO | swd3 | genetic | 22681890 | |
| YAC5_SCHPO | cph1 | genetic | 22681890 | |
| AP2M_SCHPO | apm4 | genetic | 22681890 | |
| DBR1_SCHPO | dbr1 | genetic | 22681890 | |
| MU147_SCHPO | mug147 | genetic | 22681890 | |
| PGT1_SCHPO | pgt1 | genetic | 22681890 | |
| RPA12_SCHPO | rpa12 | genetic | 22681890 | |
| MET10_SCHPO | SPCC584.01c | genetic | 22681890 | |
| MUG80_SCHPO | mug80 | genetic | 22681890 | |
| YCRA_SCHPO | SPCC285.10c | genetic | 22681890 | |
| HSP71_SCHPO | ssa1 | genetic | 22681890 | |
| YBKD_SCHPO | gmh6 | genetic | 22681890 | |
| MCP2_SCHPO | mcp2 | genetic | 22681890 | |
| ASK1_SCHPO | ask1 | genetic | 22681890 | |
| TOM70_SCHPO | tom70 | genetic | 22681890 | |
| RFP2_SCHPO | rfp2 | genetic | 22681890 | |
| DAD2_SCHPO | dad2 | genetic | 22681890 | |
| MCL1_SCHPO | mcl1 | genetic | 22681890 | |
| ASE1_SCHPO | ase1 | genetic | 22681890 | |
| UGE1_SCHPO | uge1 | genetic | 22681890 | |
| APH1_SCHPO | aph1 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...