dbPTM

SHR3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SHR3_SCHPO
UniProt AC	Q9Y876
Protein Name	Secretory component protein psh3
Gene Name	psh3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	215
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Involved in amino acid permease processing and required for the efficient translocation of structurally related amino acid permeases from the endoplasmic reticulum to the plasma membrane..
Protein Sequence	MAKRSIFRFADEKGLKVAARYGVLMSTSFIFALLFHSSVADVNTLWSPGPESAFDAAETYYTLVAGSHFIVKYTVYTIMGLNMIFHLIQATGAKGDDKLFFYSSTLLYLTALILFIVNVAPSMLVVKLQNYVQFPRNMHLSVLAASHVLVEFLLAGVILIQLGYVFGYHVQSIQQREYAEDMREQELAEKAKLESESATTQSVETVSTESVSKRK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
197	Phosphorylation	KAKLESESATTQSVE HHCHHCCCCCCCCEE	39.95	21712547
207	Phosphorylation	TQSVETVSTESVSKR CCCEEEECHHHCCCC	33.60	24763107
208	Phosphorylation	QSVETVSTESVSKRK CCEEEECHHHCCCCC	28.13	24763107
210	Phosphorylation	VETVSTESVSKRK-- EEEECHHHCCCCC--	31.60	21712547
212	Phosphorylation	TVSTESVSKRK---- EECHHHCCCCC----	35.70	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SHR3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SHR3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SHR3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
UBC15_SCHPO	ubc15	genetic	19547744

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SHR3_SCHPO

Related Literatures of Post-Translational Modification