UniProt ID | SHR3_SCHPO | |
---|---|---|
UniProt AC | Q9Y876 | |
Protein Name | Secretory component protein psh3 | |
Gene Name | psh3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 215 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Involved in amino acid permease processing and required for the efficient translocation of structurally related amino acid permeases from the endoplasmic reticulum to the plasma membrane.. | |
Protein Sequence | MAKRSIFRFADEKGLKVAARYGVLMSTSFIFALLFHSSVADVNTLWSPGPESAFDAAETYYTLVAGSHFIVKYTVYTIMGLNMIFHLIQATGAKGDDKLFFYSSTLLYLTALILFIVNVAPSMLVVKLQNYVQFPRNMHLSVLAASHVLVEFLLAGVILIQLGYVFGYHVQSIQQREYAEDMREQELAEKAKLESESATTQSVETVSTESVSKRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
197 | Phosphorylation | KAKLESESATTQSVE HHCHHCCCCCCCCEE | 39.95 | 21712547 | |
207 | Phosphorylation | TQSVETVSTESVSKR CCCEEEECHHHCCCC | 33.60 | 24763107 | |
208 | Phosphorylation | QSVETVSTESVSKRK CCEEEECHHHCCCCC | 28.13 | 24763107 | |
210 | Phosphorylation | VETVSTESVSKRK-- EEEECHHHCCCCC-- | 31.60 | 21712547 | |
212 | Phosphorylation | TVSTESVSKRK---- EECHHHCCCCC---- | 35.70 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHR3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHR3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHR3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC15_SCHPO | ubc15 | genetic | 19547744 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...