| UniProt ID | UBC15_SCHPO | |
|---|---|---|
| UniProt AC | Q9Y818 | |
| Protein Name | Ubiquitin-conjugating enzyme E2 15 | |
| Gene Name | ubc15 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 167 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the covalent attachment of ubiquitin to other proteins. Has a role in the formation of chromatin structures that influence the localization of transcriptional silencing factors.. | |
| Protein Sequence | MPSSASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSPNDESPANIDAAKEFRENPQEFKKRVRRLVRRSIEMI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of UBC15_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBC15_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBC15_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBC15_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HEL2_SCHPO | SPCC1223.01 | genetic | 18818364 | |
| AIR1_SCHPO | air1 | genetic | 18818364 | |
| RPA12_SCHPO | rpa12 | genetic | 18818364 | |
| HRR1_SCHPO | hrr1 | genetic | 18818364 | |
| DDB1_SCHPO | ddb1 | genetic | 22681890 | |
| RYH1_SCHPO | ryh1 | genetic | 22681890 | |
| YIP5_SCHPO | SPAC227.06 | genetic | 22681890 | |
| SWR1_SCHPO | swr1 | genetic | 22681890 | |
| PFL4_SCHPO | pfl4 | genetic | 22681890 | |
| PPK27_SCHPO | ppk27 | genetic | 22681890 | |
| YJ03_SCHPO | rhn1 | genetic | 22681890 | |
| RPA12_SCHPO | rpa12 | genetic | 22681890 | |
| PAM17_SCHPO | pam17 | genetic | 22681890 | |
| GYP1_SCHPO | gyp1 | genetic | 22681890 | |
| MPD2_SCHPO | mpd2 | genetic | 22681890 | |
| AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
| FKBP4_SCHPO | fkbp39 | genetic | 22681890 | |
| PMP31_SCHPO | pmp31 | genetic | 22681890 | |
| YBPD_SCHPO | SPBC16H5.13 | genetic | 22681890 | |
| RGA3_SCHPO | rga3 | genetic | 22681890 | |
| RL17B_SCHPO | rpl1702 | genetic | 22681890 | |
| LTN1_SCHPO | rkr1 | genetic | 22681890 | |
| YFFE_SCHPO | SPAC1687.14c | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
