dbPTM

PMP31_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PMP31_SCHPO
UniProt AC	O74837
Protein Name	Plasma membrane proteolipid 31
Gene Name	pmp31
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	109
Subcellular Localization	Vacuole membrane Multi-pass membrane protein .
Protein Description	Has a role in meiosis..
Protein Sequence	MSNVTLSDFLLIVLSFFVPFIVVGIRRGFCTADFLINICLCALGIPGIIHAIYIVIKYPRTVRLDIENSPNDPLVRYTPNPEHAVSPHSGPAPPSYSSLASNDNKHQSP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	Phosphorylation	VRLDIENSPNDPLVR EEEECCCCCCCCCCE	16.58	28889911
86	Phosphorylation	PNPEHAVSPHSGPAP CCHHHCCCCCCCCCC	20.06	29996109
89	Phosphorylation	EHAVSPHSGPAPPSY HHCCCCCCCCCCCCH	50.27	29996109
95	Phosphorylation	HSGPAPPSYSSLASN CCCCCCCCHHHHCCC	36.27	29996109
101	Phosphorylation	PSYSSLASNDNKHQS CCHHHHCCCCCCCCC	50.43	29996109
108	Phosphorylation	SNDNKHQSP------ CCCCCCCCC------	32.09	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PMP31_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PMP31_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PMP31_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PMP31_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PMP31_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-69, AND MASSSPECTROMETRY.	18257517 [Abstract]