UniProt ID | FKBP4_SCHPO | |
---|---|---|
UniProt AC | O74191 | |
Protein Name | FK506-binding protein 39 kDa | |
Gene Name | fkbp39 {ECO:0000303|PubMed:10544281} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 361 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . | |
Protein Description | PPIase that acts as a histone chaperone. [PubMed: 14981505 Histone proline isomerase that increases the rate of cis-trans isomerization at prolines on the histone H3 N-terminal tail. Proline isomerization influences H3 methylation thereby regulating gene expression (By similarity] | |
Protein Sequence | MSLPIAVYSLSVKGKDVPAVEESTDASIHLTMASIDAGEKSNKPTTLLVKVRPRIPVEDEDDEELDEQMQELLEESQREFVLCTLKPGSLYQQPLNLTITPGDEVFFSASGDATIHLSGNFLVDEEDEEEEESDEDYDLSPTEEDLVETVSGDEESEEESESEDNSASEEDELDSAPAKKAQVKKKRTKDESEQEEAASPKKNNTKKQKVEGTPVKEKKVAFAEKLEQGPTGPAAKKEKQQASSNAPSSPKTRTLKGGVVVTDVKTGSGASATNGKKVEMRYIGKLENGKVFDKNTKGKPFAFILGRGEVIRGWDVGVAGMQEGGERKITIPAPMAYGNQSIPGIPKNSTLVFEVKLVRVH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | SIDAGEKSNKPTTLL EECCCCCCCCCEEEE | 45.87 | 25720772 | |
188 | Phosphorylation | AQVKKKRTKDESEQE HHHHHCCCCCHHHHH | 52.29 | 25720772 | |
192 | Phosphorylation | KKRTKDESEQEEAAS HCCCCCHHHHHHHHC | 55.50 | 28889911 | |
199 | Phosphorylation | SEQEEAASPKKNNTK HHHHHHHCCCCCCCC | 44.28 | 28889911 | |
205 | Phosphorylation | ASPKKNNTKKQKVEG HCCCCCCCCCCEECC | 49.35 | 29996109 | |
213 | Phosphorylation | KKQKVEGTPVKEKKV CCCEECCCCCCHHHH | 16.05 | 28889911 | |
243 | Phosphorylation | KKEKQQASSNAPSSP HHHHHHHHCCCCCCC | 21.56 | 29996109 | |
244 | Phosphorylation | KEKQQASSNAPSSPK HHHHHHHCCCCCCCC | 39.77 | 29996109 | |
248 | Phosphorylation | QASSNAPSSPKTRTL HHHCCCCCCCCCCEE | 57.79 | 21712547 | |
249 | Phosphorylation | ASSNAPSSPKTRTLK HHCCCCCCCCCCEEE | 29.38 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP4_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...